PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g23890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 335aa    MW: 37588.5 Da    PI: 9.2395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g23890genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  +++++G g+W++ + + g++R++k+c++rw +yl
       CA01g23890 14 KGPWTPEEDQKLTYYIEKHGCGSWRALPTKAGLKRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.45.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia ++  +Rt++++k++w+++l
       CA01g23890  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLA-NRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.181961IPR017930Myb domain
SuperFamilySSF466897.26E-3011108IPR009057Homeodomain-like
SMARTSM007177.7E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-241568IPR009057Homeodomain-like
CDDcd001673.07E-101661No hitNo description
PROSITE profilePS5129425.61462116IPR017930Myb domain
SMARTSM007173.0E-1666114IPR001005SANT/Myb domain
PfamPF002492.9E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2569116IPR009057Homeodomain-like
CDDcd001679.84E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLTYYIE KHGCGSWRAL PTKAGLKRCG KSCRLRWINY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLANRT DNEIKNYWNT HLKKRLTKMG  120
IDPNTHKPRS NFGSANLSHM AQWENARLEA EARLVRESKK QQQIILINND INNYNNIHFG  180
TNNLGTKNVL LPLQTKLPSL PCLDVLKAWQ GGANWSNWPK IKKDKFFDNF PTSSASLSNN  240
NLLLMVPSNN NNNNNILGAG VVNTCLVGAG SFLGNNINEI SSYSSYPCLN DIQGFTQLES  300
VVGSCQDDYD NNDNNYWNTI LNSCTSLADG SPVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-102HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556225.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLA0A1U8FKD40.0A0A1U8FKD4_CAPAN; myb-related protein Hv1-like
STRINGPGSC0003DMT4000624371e-174(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.17e-94myb domain protein 16