PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g20220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 368aa    MW: 40758.2 Da    PI: 6.3726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g20220genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-153279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
       CA01g20220 32 KGLWSPEEDEKLMNYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 79
                     678*******************************************97 PP

2Myb_DNA-binding52.31.3e-1685128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+v+++  lG++ W+ Ia++++ gRt++++k++w++
       CA01g20220  85 RGAFSPQEEELIVHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 128
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7682779IPR017930Myb domain
SuperFamilySSF466892.19E-2830126IPR009057Homeodomain-like
SMARTSM007173.9E-113181IPR001005SANT/Myb domain
PfamPF002498.3E-143279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-233386IPR009057Homeodomain-like
CDDcd001678.67E-103579No hitNo description
PROSITE profilePS5129425.53480134IPR017930Myb domain
SMARTSM007179.0E-1684132IPR001005SANT/Myb domain
PfamPF002496.1E-1585128IPR001005SANT/Myb domain
CDDcd001671.98E-1187127No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2587135IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MRKPEHNSSN PSPSTMMKEK EKEKGNKAKL RKGLWSPEED EKLMNYMLTN GQGCWSDIAR  60
NAGLQRCGKS CRLRWINYLR PDLKRGAFSP QEEELIVHLH SILGNRWSQI AARLPGRTDN  120
EIKNFWNSTI KKRLKNNNNN NNHSNNSTPS PNASDSSSDP RALVGGIFPM QGHDVNVMAA  180
FCMDNSSSTT SGSSMQAMVP SNHFNPFPQL DNTSYDISGL VGPVNLGQFG CNGCDGGFLD  240
YGVEETYSMM GLESDEFSVP PLGGVHKSTM GENNNNNSHV NFSSNIVIGA NDYMVEKKIT  300
NGNNNNNNQH LVNMSGSSDQ SLKVEDYMVG FGNHNHWHGE SLRIGEFDWE GLLANVSSLP  360
YLDFQVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27301345108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-147HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556827.10.0PREDICTED: transcription factor RAX1
TrEMBLA0A1U8FBW00.0A0A1U8FBW0_CAPAN; transcription factor RAX1
TrEMBLA0A2G3AK690.0A0A2G3AK69_CAPAN; Transcription factor MYB86
STRINGPGSC0003DMT4000177090.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.15e-69myb domain protein 83