PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA01g19720 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 98aa MW: 10837.5 Da PI: 10.164 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60.7 | 1.8e-19 | 15 | 48 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C++C++ kTp+WR gp g+ktLCnaCG++y++ + CA01g19720 15 CTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGR 48 *******************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 5.7E-16 | 8 | 71 | No hit | No description |
PROSITE profile | PS50114 | 12.268 | 9 | 45 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 8.3E-15 | 9 | 63 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.2E-15 | 12 | 47 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.07E-11 | 14 | 63 | No hit | No description |
Pfam | PF00320 | 2.3E-17 | 15 | 48 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 15 | 40 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MKKSSLTEPG SGRRCTHCQV QKTPQWRAGP LGPKTLCNAC GVRYKSGRLY PEYRPACSPT 60 FSQEVHSNSH RKVLEMRRKK ETGEVIEPGL ASMISTC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-101 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016539828.1 | 9e-66 | PREDICTED: GATA transcription factor 5 | ||||
Swissprot | Q9FH57 | 2e-40 | GATA5_ARATH; GATA transcription factor 5 | ||||
TrEMBL | A0A1U8DXS6 | 2e-64 | A0A1U8DXS6_CAPAN; GATA transcription factor | ||||
TrEMBL | A0A2G2XNY6 | 2e-64 | A0A2G2XNY6_CAPBA; GATA transcription factor | ||||
TrEMBL | A0A2G3AH04 | 2e-65 | A0A2G3AH04_CAPAN; Uncharacterized protein | ||||
TrEMBL | A0A2G3BW35 | 2e-64 | A0A2G3BW35_CAPCH; GATA transcription factor | ||||
STRING | XP_009802570.1 | 6e-57 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1154 | 24 | 81 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66320.2 | 1e-42 | GATA transcription factor 5 |