PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g15760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 281aa    MW: 31871.2 Da    PI: 8.3728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g15760genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.67.9e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++ Ed +l+d++ ++G g+W++++   g+ Rt+k+c++rw +yl
       CA01g15760 15 RGLWSPYEDHKLKDYILKHGHGCWASVPINSGLQRTGKSCRLRWINYL 62
                     788*******************************************97 PP

2Myb_DNA-binding551.8e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++teE+e ++ ++ +lG++ W+ Ia++++ gRt++++k++w+++l
       CA01g15760  68 RGTFSTEEEETILTLHGMLGNK-WSQIAQHLP-GRTDNEIKNHWHSHL 113
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-21965IPR009057Homeodomain-like
PROSITE profilePS5129415.8251062IPR017930Myb domain
SuperFamilySSF466892.31E-2813109IPR009057Homeodomain-like
SMARTSM007175.4E-91464IPR001005SANT/Myb domain
PfamPF002495.7E-131562IPR001005SANT/Myb domain
CDDcd001671.27E-71862No hitNo description
PROSITE profilePS5129426.79563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2666117IPR009057Homeodomain-like
SMARTSM007179.5E-1667115IPR001005SANT/Myb domain
PfamPF002491.2E-1568113IPR001005SANT/Myb domain
CDDcd001671.06E-1070113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGCKQMDKPK QKHKRGLWSP YEDHKLKDYI LKHGHGCWAS VPINSGLQRT GKSCRLRWIN  60
YLRPGLKRGT FSTEEEETIL TLHGMLGNKW SQIAQHLPGR TDNEIKNHWH SHLKKSVSKM  120
AKTYSENAEA SSSSMKLVSK KSANLGSFEL VEGALLADIH QSTLHVQLPQ ENCECNLPKV  180
LFSEWLSLDQ FNVQDFKNTI KQHHSKNNYG CNDSVFQLDA FAQYGPLLAM NEAITYGNDI  240
NGGFNNMFQP PLKFDNQIFV NGFEEFISGE FNMNGGVMYI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22151187109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016557291.10.0PREDICTED: transcription factor LAF1-like
TrEMBLA0A2G3AJG40.0A0A2G3AJG4_CAPAN; Transcription factor MYB86
STRINGXP_009792992.11e-123(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.16e-57myb domain protein 19