PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g13490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 510aa    MW: 55305.3 Da    PI: 5.5553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g13490genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-163380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +lvd+v   G g+W+++ r+ g+ R++k+c++rw ++l
       CA01g13490 33 KGPWTTVEDAILVDYVMTNGEGNWNAVQRHSGLARCGKSCRLRWANHL 80
                     79******************************************9986 PP

2Myb_DNA-binding51.62.1e-1686129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
       CA01g13490  86 KGAFTPEEERRILELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 129
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8062880IPR017930Myb domain
SuperFamilySSF466891.25E-2830127IPR009057Homeodomain-like
SMARTSM007175.5E-123282IPR001005SANT/Myb domain
PfamPF002491.3E-133380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-223487IPR009057Homeodomain-like
CDDcd001672.28E-93580No hitNo description
PROSITE profilePS5129426.21581135IPR017930Myb domain
SMARTSM007172.7E-1685133IPR001005SANT/Myb domain
PfamPF002492.2E-1586129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2688134IPR009057Homeodomain-like
CDDcd001675.27E-1288129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MSITSETDDM MTSKVDIDSP DEASGGESVP LKKGPWTTVE DAILVDYVMT NGEGNWNAVQ  60
RHSGLARCGK SCRLRWANHL RPDLKKGAFT PEEERRILEL HAKMGNKWAR MAAELPGRTD  120
NEIKNYWNTR IKRRQRAGLP VYPPDISFLA NQNKQNEELG AFSSVDAQNS NVLGINNFEI  180
PAVEFKNLQL DHLLYPPPLG EIPAVSSFLA QGHRAPYGST YLLSTMHPSK RIRGSESMFS  240
GSNGDLLLSS SQYHNGGSLL AQPLGFSSYN HHLTYDDDRS FSSVVHGGHA CLNGNSSSSE  300
PTWAMKLELP SLQNQTANWG SPPSPLPSLE SDDILIQSPP AGNSESGSLS PSNSGLLDAV  360
LYESQTMKAS NDNSHQGKET SGDAVNKGWE SYGDPVSPLH HFSASVFGEY TPVNGSSLHE  420
FPSVATMPGC KIKKEIGDLA PLDENDDSLN QTIFSSPKTQ HAKNSLALKE VISSGFFDDC  480
GWDCKQIRAV ATSSGQACGR SSWDAMSAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29311345107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1754740.0EF175474.1 Solanum lycopersicum GAMyb-like1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578083.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor GAMYB
TrEMBLA0A2G3AI600.0A0A2G3AI60_CAPAN; Transcription factor MYB57
STRINGPGSC0003DMT4000584260.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-71myb domain protein 33