PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA01g05840 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 165aa MW: 18897.7 Da PI: 10.013 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 59 | 7.5e-19 | 14 | 68 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++k+q +Lee F+++++++ +++ LAk+lgL rqV vWFqNrRa+ k CA01g05840 14 RKKLRLSKDQSVILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 68 788899***********************************************98 PP | |||||||
2 | HD-ZIP_I/II | 129.7 | 1.2e-41 | 14 | 103 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +kk+rlsk+q+ +LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l CA01g05840 14 RKKLRLSKDQSVILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 103 69*************************************************************************************9.55 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.63E-18 | 9 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.167 | 10 | 70 | IPR001356 | Homeobox domain |
SMART | SM00389 | 8.4E-16 | 12 | 74 | IPR001356 | Homeobox domain |
CDD | cd00086 | 2.63E-13 | 14 | 71 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.1E-18 | 14 | 68 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.8E-16 | 14 | 68 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 1.2E-5 | 41 | 50 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 45 | 68 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 1.2E-5 | 50 | 66 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 9.1E-12 | 70 | 104 | IPR003106 | Leucine zipper, homeobox-associated |
SMART | SM00340 | 4.2E-27 | 70 | 113 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MERGSDEEDG ETSRKKLRLS KDQSVILEES FKEHNTLNPK QKLALAKRLG LRPRQVEVWF 60 QNRRARTKLK QTEVDCEFLK RCCENLTEEN RRLQKEVQEL RALKLSPQFY MQMTPPTTLT 120 MCPSCERVGA PPSSSSGPTS TPMGQAQPRP MPFNLWANAL HPRS* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 12 | 18 | SRKKLRL |
2 | 62 | 70 | RRARTKLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP010783 | 1e-136 | AP010783.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0006F21, complete sequence. | |||
GenBank | HG975520 | 1e-136 | HG975520.1 Solanum lycopersicum chromosome ch08, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016570126.1 | 1e-118 | PREDICTED: homeobox-leucine zipper protein HAT4-like | ||||
Swissprot | Q05466 | 8e-81 | HAT4_ARATH; Homeobox-leucine zipper protein HAT4 | ||||
TrEMBL | A0A1U8GFP9 | 1e-116 | A0A1U8GFP9_CAPAN; homeobox-leucine zipper protein HAT4-like | ||||
TrEMBL | A0A2G2XL32 | 1e-116 | A0A2G2XL32_CAPBA; Homeobox-leucine zipper protein HAT4 | ||||
TrEMBL | A0A2G3AEW4 | 1e-117 | A0A2G3AEW4_CAPAN; Homeobox-leucine zipper protein HAT4 | ||||
STRING | PGSC0003DMT400067540 | 1e-102 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1118 | 24 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16780.1 | 5e-79 | homeobox protein 2 |