PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g04550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 279aa    MW: 31703.5 Da    PI: 5.0928
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g04550genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
       CA01g04550 14 KGPWTTEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.11.3e-1571111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +  E++  +d++++lG++ W++Ia++++ gRt++++k++w+++
       CA01g04550  71 SDAEEKMVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.734961IPR017930Myb domain
SuperFamilySSF466893.88E-2611108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002497.8E-151461IPR001005SANT/Myb domain
CDDcd001672.14E-81661No hitNo description
PROSITE profilePS5129425.65662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2463116IPR009057Homeodomain-like
SMARTSM007174.4E-1466114IPR001005SANT/Myb domain
CDDcd001672.51E-1071112No hitNo description
PfamPF002497.3E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTTE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEKMVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLI KEENPTDQPI QESDQNKNNY HQQVVVVTSG ATSSELDNSS TSSSSASSSE  180
NSCNESKLVL DTFKENDPLL SCLLEADDAP PLIDSSWELP VKSFDNNNNN MTSSWDDENF  240
NWLFDCQDFG IHDFGFDNCF NDVELEVFNT IYDMENKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtR2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7939141e-158JF793914.1 Petunia axillaris isolate S7 MYB transcription factor ODO1 (ODO1) mRNA, complete cds.
GenBankJF7939161e-158JF793916.1 Petunia exserta MYB transcription factor ODO1 (ODO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568805.10.0PREDICTED: protein ODORANT1-like
RefseqXP_016568810.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-143ODO1_PETHY; Protein ODORANT1
TrEMBLA0A1U8GCE30.0A0A1U8GCE3_CAPAN; Protein ODORANT1
TrEMBLA0A2G3AEK20.0A0A2G3AEK2_CAPAN; protein ODORANT1-like
STRINGSolyc08g079270.2.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.17e-94myb domain protein 42
Publications ? help Back to Top
  1. Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC
    ODORANT1 regulates fragrance biosynthesis in petunia flowers.
    Plant Cell, 2005. 17(5): p. 1612-24
    [PMID:15805488]