PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA01g00300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 154aa MW: 17641.5 Da PI: 10.2041 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 64.1 | 2e-20 | 24 | 77 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 R++f++eq++ Le++F ++ p +++++LA++lgL+ rqV +WFqN+Ra+ k CA01g00300 24 MRRRFNDEQIKSLENMFSTESRPELRTKQQLARSLGLQPRQVAIWFQNKRARSK 77 699*************************************************99 PP | |||||||
2 | HD-ZIP_I/II | 103.4 | 1.9e-33 | 25 | 112 | 3 | 90 |
HD-ZIP_I/II 3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 +rr+++eq+k+LE++F++e++ e + K++lar+Lglqprqva+WFqn+RAR k+kqlE +y++L+ +yd+l ++ e L+ke+e+L + CA01g00300 25 RRRFNDEQIKSLENMFSTESRPELRTKQQLARSLGLQPRQVAIWFQNKRARSKSKQLELEYRMLQMSYDNLGSKYELLKKEHESLLLQ 112 79*********************************************************************************99755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 5.43E-19 | 7 | 81 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.0E-18 | 14 | 79 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.459 | 19 | 79 | IPR001356 | Homeobox domain |
SMART | SM00389 | 5.4E-16 | 21 | 83 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 5.5E-18 | 24 | 77 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.66E-15 | 25 | 80 | No hit | No description |
PRINTS | PR00031 | 4.0E-6 | 50 | 59 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 54 | 77 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 4.0E-6 | 59 | 75 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 8.4E-10 | 79 | 113 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MPPTNSDIWG QSMSSSIKKC KDSMRRRFND EQIKSLENMF STESRPELRT KQQLARSLGL 60 QPRQVAIWFQ NKRARSKSKQ LELEYRMLQM SYDNLGSKYE LLKKEHESLL LQVIFIYSLS 120 FLGICVVGGG ANKGKFCWPI SVNCVTISSK SFC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP009261 | 3e-97 | AP009261.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0005L01, complete sequence. | |||
GenBank | HG975520 | 3e-97 | HG975520.1 Solanum lycopersicum chromosome ch08, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016552550.1 | 5e-75 | PREDICTED: homeobox-leucine zipper protein ATHB-7-like | ||||
Swissprot | P46897 | 1e-32 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A1U8FA08 | 1e-73 | A0A1U8FA08_CAPAN; Homeobox-leucine zipper protein HOX6 | ||||
TrEMBL | A0A2G3AD42 | 1e-73 | A0A2G3AD42_CAPAN; homeobox-leucine zipper protein ATHB-7-like | ||||
STRING | Solyc08g083130.2.1 | 1e-62 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA10273 | 21 | 25 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46680.2 | 1e-30 | homeobox 7 |
Publications ? help Back to Top | |||
---|---|---|---|
|