PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA00g96280

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

G2-like

Protein Properties

Length: 209aa MW: 23748.1 Da PI: 9.7857

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA00g96280	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	92.7	2.9e-29	138	188	2	52
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ CA00g96280 138 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQV 188 9*************************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.97E-14	135	191	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	8.1E-26	135	188	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.5E-22	138	189	IPR006447	Myb domain, plants
Pfam	PF00249	2.7E-6	139	189	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 209 aa Download sequence Send to blast
MVESTNSMLN NNSNTCSCFE LSLSNNPTKP NNYSCDPNSS HHLQNYILQQ NQRIITTREL 60 GFLMQPIRGI PVYHQKPFDN TITTFPIPSS SNCSILNNIN NNNTISSCDS TSPNFQQGGF 120 LRSRFYSRFP GKRSTRAPRM RWTSTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA 180 HVKSHLQVHI VKTFCYFSLI MPLHLKFF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	5e-16	139	187	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	5e-16	139	187	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	5e-16	139	187	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	5e-16	139	187	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	5e-16	139	187	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016573194.1	1e-124	PREDICTED: probable transcription factor KAN2
Swissprot	Q93WJ9	1e-43	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	A0A2G3AFV7	1e-135	A0A2G3AFV7_CAPAN; Uncharacterized protein (Fragment)
STRING	Solyc08g076400.2.1	8e-71	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2738	22	55

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G32240.1	6e-37	G2-like family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]