PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g89710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 306aa    MW: 34436.4 Da    PI: 10.8396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g89710genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-172976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l ++vk++G g+W+++ r  g+ R++k+c++rw ++l
       CA00g89710 29 KGPWTTTEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANHL 76
                     79******************************************9986 PP

2Myb_DNA-binding46.77.4e-1582125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++ +E+ l+v+++++lG++ W++ a+ ++ gRt++++k++w++
       CA00g89710  82 KGAFSIDEERLIVELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 125
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8582476IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-232579IPR009057Homeodomain-like
SuperFamilySSF466893.75E-2928123IPR009057Homeodomain-like
SMARTSM007171.2E-122878IPR001005SANT/Myb domain
PfamPF002495.9E-152976IPR001005SANT/Myb domain
CDDcd001676.04E-113176No hitNo description
PROSITE profilePS5129424.59977131IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2380130IPR009057Homeodomain-like
SMARTSM007171.3E-1381129IPR001005SANT/Myb domain
PfamPF002498.4E-1482125IPR001005SANT/Myb domain
CDDcd001673.42E-1088127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAPNGGGVNK NNNGTSIGRN HNTRQVLKKG PWTTTEDAIL MEYVKKHGEG NWNAVQRNSG  60
LMRCGKSCRL RWANHLRPHL KKGAFSIDEE RLIVELHAKL GNKWARMAAQ LPGRTDNEIK  120
NYWNTRLKRR QRAGLPIYPQ DIQPQNYQQD QNQQHSTNIP SPFDNNHQNS NYNNNNSPLS  180
LLDIFNPSTM KPSRNIIPHQ YQFNNNNPSS SFLTNTNNIN NQVKFFRDPR VSLSLTLASS  240
MKNSQLPSMI APVPNNFSQG YSSSIPAPPL QHNYPNFTTT TRPFSGISSN PNGLILGTRA  300
SAQHE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29271305107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016541449.10.0PREDICTED: transcription factor GAMYB-like
SwissprotO808833e-73MB101_ARATH; Transcription factor MYB101
TrEMBLA0A1U8EC560.0A0A1U8EC56_CAPAN; Transcription repressor MYB5
TrEMBLA0A2G2YTX80.0A0A2G2YTX8_CAPAN; transcription factor GAMYB-like
STRINGPGSC0003DMT4000360861e-174(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.27e-70myb domain protein 101
Publications ? help Back to Top
  1. Zheng Z, et al.
    Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy.
    Plant Physiol., 2017. 174(3): p. 1764-1778
    [PMID:28515145]
  2. Xue T,Liu Z,Dai X,Xiang F
    Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101.
    Plant Sci., 2017. 262: p. 182-189
    [PMID:28716415]