PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA00g88900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 279aa MW: 31499.3 Da PI: 4.9755 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.8 | 4.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv +++ G g+W++ ++ g+ R++k+c++rw +yl CA00g88900 14 KGPWTPEEDQILVSYIQANGHGNWRALPKLAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 51 | 3.2e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l CA00g88900 67 RGNFTREEEDSIIQLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.621 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.28E-30 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.83E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.108 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-26 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.9E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.72E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 279 aa Download sequence Send to blast |
MVRAPCCEKM GLKKGPWTPE EDQILVSYIQ ANGHGNWRAL PKLAGLLRCG KSCRLRWTNY 60 LRPDIKRGNF TREEEDSIIQ LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKNYQ 120 APENSKRHCK KNIDSKAPST SQITLKSSHN FSNIKEGING PDPNSPQLSS SEVSTVTADS 180 ESVMTMGVTN GGDQMDSYEN FIPEIDESFW TDDLLSTADN SNFDMAISGG EELQGQFPFY 240 DMKQESVELD VGAKLEDDMD FWYNVFIKSG DLLELPEF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-27 | 12 | 116 | 5 | 108 | B-MYB |
1gv2_A | 7e-27 | 12 | 116 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 8e-27 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 7e-27 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 7e-27 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00375 | DAP | Transfer from AT3G23250 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU560897 | 0.0 | EU560897.1 Capsicum annuum clone NW040106 myb-related transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001311814.1 | 0.0 | myb-related protein Myb4-like | ||||
Swissprot | Q9LTC4 | 5e-88 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | A0A1U8G3M0 | 0.0 | A0A1U8G3M0_CAPAN; Transcription repressor MYB4 | ||||
TrEMBL | A0A2G2ZUP4 | 0.0 | A0A2G2ZUP4_CAPAN; myb-related protein Myb4-like | ||||
STRING | PGSC0003DMT400044362 | 1e-171 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 2e-90 | myb domain protein 15 |