PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g88900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 279aa    MW: 31499.3 Da    PI: 4.9755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g88900genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +++  G g+W++ ++  g+ R++k+c++rw +yl
       CA00g88900 14 KGPWTPEEDQILVSYIQANGHGNWRALPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding513.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
       CA00g88900  67 RGNFTREEEDSIIQLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.621961IPR017930Myb domain
SuperFamilySSF466891.28E-3010108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001672.83E-101661No hitNo description
PROSITE profilePS5129425.10862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2665117IPR009057Homeodomain-like
SMARTSM007172.9E-1466114IPR001005SANT/Myb domain
PfamPF002493.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.72E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILVSYIQ ANGHGNWRAL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TREEEDSIIQ LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKNYQ  120
APENSKRHCK KNIDSKAPST SQITLKSSHN FSNIKEGING PDPNSPQLSS SEVSTVTADS  180
ESVMTMGVTN GGDQMDSYEN FIPEIDESFW TDDLLSTADN SNFDMAISGG EELQGQFPFY  240
DMKQESVELD VGAKLEDDMD FWYNVFIKSG DLLELPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27121165108B-MYB
1gv2_A7e-27121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-271211625128MYB TRANSFORMING PROTEIN
1mse_C7e-27121162105C-Myb DNA-Binding Domain
1msf_C7e-27121162105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5608970.0EU560897.1 Capsicum annuum clone NW040106 myb-related transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001311814.10.0myb-related protein Myb4-like
SwissprotQ9LTC45e-88MYB15_ARATH; Transcription factor MYB15
TrEMBLA0A1U8G3M00.0A0A1U8G3M0_CAPAN; Transcription repressor MYB4
TrEMBLA0A2G2ZUP40.0A0A2G2ZUP4_CAPAN; myb-related protein Myb4-like
STRINGPGSC0003DMT4000443621e-171(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-90myb domain protein 15
Publications ? help Back to Top
  1. Schnaubelt D, et al.
    Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana.
    Plant Cell Environ., 2015. 38(2): p. 266-79
    [PMID:24329757]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  4. Kim SH, et al.
    Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis.
    Nucleic Acids Res., 2017. 45(11): p. 6613-6627
    [PMID:28510716]
  5. Chezem WR,Memon A,Li FS,Weng JK,Clay NK
    SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(8): p. 1907-1926
    [PMID:28733420]
  6. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]