PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g82220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 302aa    MW: 34256 Da    PI: 7.7273
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g82220genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l++ + ++G+g +W + +++ g++R++k+c++rw++yl
       CA00g82220 14 RGPWSPEEDAKLKEFIDKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding38.92e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++  + +  G++ W+ Ia+ ++ gRt++++k++w++
       CA00g82220  69 GDFSDEEDRIICSLYANIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.18962IPR017930Myb domain
SuperFamilySSF466893.84E-2711109IPR009057Homeodomain-like
SMARTSM007173.6E-121364IPR001005SANT/Myb domain
PfamPF002494.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241569IPR009057Homeodomain-like
CDDcd001678.45E-91662No hitNo description
PROSITE profilePS5129422.45763117IPR017930Myb domain
SMARTSM007171.9E-1167115IPR001005SANT/Myb domain
PfamPF002493.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2470117IPR009057Homeodomain-like
CDDcd001671.03E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRAPCCDKN NVKRGPWSPE EDAKLKEFID KYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSDEEDRIIC SLYANIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGF  120
IHTSSNQRIK SPNLFLPPTT FPPQIQSQAI SNIFKDDYLE PISSLQPNFM YHNNNMNFQL  180
GTNNQYSYFL ESLMNPMQAS CSSSDGSCSQ IPRSNFEETQ KFTLDNYGNN GGTWADHDQK  240
PDGYFGNNHQ NHSSQFQYDT SNIEEVKELI SSSSSNGNGC NNNNNMLFFS DENKANIGYW  300
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4965861e-102JF496586.1 Capsicum annuum BLIND (BLIND) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576886.10.0PREDICTED: transcription factor RAX2-like isoform X1
TrEMBLA0A1U8H0740.0A0A1U8H074_CAPAN; Transcription factor RAX2
TrEMBLA0A2G2ZDW40.0A0A2G2ZDW4_CAPAN; transcription factor RAX2-like isoform X1
STRINGSolyc06g074910.2.11e-128(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-78myb domain protein 36