PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g75700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 327aa    MW: 35521.6 Da    PI: 9.7138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g75700genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.5e-201156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell  +v+++G+++W++I++ ++ gR++k+c++rw + 
       CA00g75700 11 KGPWSPEEDELLQSLVEKHGPRNWTLISKSVP-GRSGKSCRLRWCNQ 56
                     79******************************.***********985 PP

2Myb_DNA-binding56.56.6e-1865107347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
       CA00g75700  65 AFTPEEDETIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 107
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.285661IPR017930Myb domain
SuperFamilySSF466892.96E-328104IPR009057Homeodomain-like
SMARTSM007178.7E-181059IPR001005SANT/Myb domain
PfamPF002491.0E-191156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-261264IPR009057Homeodomain-like
CDDcd001676.84E-171355No hitNo description
SMARTSM007173.4E-1562110IPR001005SANT/Myb domain
PROSITE profilePS5129421.9363112IPR017930Myb domain
PfamPF002493.9E-1565107IPR001005SANT/Myb domain
CDDcd001671.45E-1265108No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2365111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAARKDSDRI KGPWSPEEDE LLQSLVEKHG PRNWTLISKS VPGRSGKSCR LRWCNQLSPQ  60
VEHRAFTPEE DETIIRAHAK FGNKWATIAR LLSGRTDNAI KNHWNSTLKR KCPSMSEDLS  120
FDNPQPPLKR SASVGPSMMN PGSPSGSDLS DSGLSGSGSG LDLPQPLVYR PVPRTGCIFP  180
LPPTPAPSVP DPPTSLSLSL PGSVSVPGSG SFEKPRQSPQ TPPLPPPQPP PFAAVEKPIP  240
PPVPVLSSTP PFMAQVPQTQ QQSYEFCAPK SGEKQFFSPE FLSVLQAMIR KEVKSYMSGF  300
EKNGFCLQTD AIRNAVIKRI GISKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-40101113104C-Myb DNA-Binding Domain
1msf_C3e-40101113104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568808.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A1U8GJA20.0A0A1U8GJA2_CAPAN; Uncharacterized protein
TrEMBLA0A2G2ZRH80.0A0A2G2ZRH8_CAPAN; transcription factor MYB44-like
STRINGSolyc04g078420.1.11e-159(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.17e-70myb domain protein 73