PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA00g74270 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 161aa MW: 17826.1 Da PI: 11.1304 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.5 | 9.2e-33 | 22 | 78 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d p+YVNaKQy++Il+RRq Rakle+++kl k+rkpylheSRh hA++R RgsgGrF CA00g74270 22 DGPIYVNAKQYHGILRRRQIRAKLEAQNKL-VKNRKPYLHESRHLHAVNRVRGSGGRF 78 57****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-35 | 20 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 35.798 | 21 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.8E-28 | 24 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 5.0E-24 | 24 | 46 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 26 | 46 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 5.0E-24 | 55 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MQPQMMGIAP ARVPLPVDIA EDGPIYVNAK QYHGILRRRQ IRAKLEAQNK LVKNRKPYLH 60 ESRHLHAVNR VRGSGGRFLS SKKALQSDPN SYPANSTSSR DSVEHEGSTS AFSSVRQDVI 120 HNGISFQQQQ QPDQMAFSVS SHMGINMQGN GTQQRAPVVR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-22 | 22 | 83 | 2 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016540349.1 | 1e-112 | PREDICTED: nuclear transcription factor Y subunit A-4-like | ||||
Refseq | XP_016540350.1 | 1e-112 | PREDICTED: nuclear transcription factor Y subunit A-4-like | ||||
Refseq | XP_016540351.1 | 1e-112 | PREDICTED: nuclear transcription factor Y subunit A-4-like | ||||
Swissprot | Q9SYH4 | 1e-37 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
TrEMBL | A0A1U8EAK4 | 1e-111 | A0A1U8EAK4_CAPAN; nuclear transcription factor Y subunit A-4-like | ||||
STRING | Solyc12g009050.1.1 | 1e-100 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5009 | 23 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 7e-40 | nuclear factor Y, subunit A5 |