PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g71020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 255aa    MW: 29118.1 Da    PI: 9.3298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g71020genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+l+++  + G ++W+++++  g++R++k+c++rw++yl
       CA00g71020 16 KGPWTKDEDEKLIEYTYKNGHNNWRLVPKNAGLKRCGKSCRLRWNNYL 63
                     79*********************************************7 PP

2Myb_DNA-binding50.74.3e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eE++++++++  +G++ W++Ia +++  Rt++++k+++++yl
       CA00g71020  69 RGGFTKEEEQIIINLHSSFGNK-WSRIATHLP-ERTDNEIKNFYNTYL 114
                      788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.9731167IPR017930Myb domain
SuperFamilySSF466893.88E-2913110IPR009057Homeodomain-like
SMARTSM007174.2E-151565IPR001005SANT/Myb domain
PfamPF002496.6E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231771IPR009057Homeodomain-like
CDDcd001673.74E-121863No hitNo description
PROSITE profilePS5129418.80768118IPR017930Myb domain
SMARTSM007177.7E-1568116IPR001005SANT/Myb domain
PfamPF002499.0E-1569114IPR001005SANT/Myb domain
CDDcd001677.23E-1272114No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2472118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRYPCCNYD DSDLKKGPWT KDEDEKLIEY TYKNGHNNWR LVPKNAGLKR CGKSCRLRWN  60
NYLKPGIKRG GFTKEEEQII INLHSSFGNK WSRIATHLPE RTDNEIKNFY NTYLGKKLLK  120
LGIDPKTHKP ISHINSLIFT PTLRLQAQVT LQAKIQQFLQ SRPNSSLNTN LFSSIQENFL  180
SNPIQGAIYQ FLNCLQPNFT ITTPCLDNTT NSLPNGYSSI SNSVEVPSEK INKIETIQKI  240
STLSLCEEDT QTEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131184108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019240410.11e-103PREDICTED: transcription factor MYB34-like
SwissprotQ9S9Z27e-61MYB93_ARATH; Transcription factor MYB93
TrEMBLA0A2G2XWU00.0A0A2G2XWU0_CAPAN; Transcription factor MYB28
STRINGXP_009789695.11e-101(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.28e-67myb domain protein 9
Publications ? help Back to Top
  1. Gibbs DJ,Coates JC
    AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis.
    Plant Signal Behav, 2014. 9(10): p. e970406
    [PMID:25482809]