PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g69840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 358aa    MW: 39953.2 Da    PI: 6.5093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g69840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.5e-153077148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ +ar  g+ R++k+c++rw +yl
       CA00g69840 30 KGLWSPEEDEKLMHYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 77
                     678*******************************************97 PP

2Myb_DNA-binding46.21.1e-1483127147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E+e +++++ +lG++ W+ Ia++++ gRt++++k++w++ 
       CA00g69840  83 RGAFLPQEEEHIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNST 127
                      78999*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5862577IPR017930Myb domain
SuperFamilySSF466891.37E-2728124IPR009057Homeodomain-like
SMARTSM007171.4E-102979IPR001005SANT/Myb domain
PfamPF002491.7E-133077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-213184IPR009057Homeodomain-like
CDDcd001671.04E-83377No hitNo description
PROSITE profilePS5129423.70878132IPR017930Myb domain
SMARTSM007173.0E-1382130IPR001005SANT/Myb domain
PfamPF002491.9E-1383127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2485133IPR009057Homeodomain-like
CDDcd001676.78E-985128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MRKPEFSSSS SSGKNNNNNT NNNTNVKLRK GLWSPEEDEK LMHYMLTNGQ GCWSDVARNA  60
GLQRCGKSCR LRWINYLRPD LNRGAFLPQE EEHIIHLHSL LGNRWSQIAA RLPGRTDNEI  120
KNFWNSTLKK RLKNSSSSST PSPNASDSSS DHLSKDLNIG ITQQRFMTMQ KHNLMSINMD  180
STSSSSSSMA LNTINIDPLP TLDHTLINMS NGFNIAPSYL STTQPCMVQG GNIVGTNNGG  240
SLFYGNNHGI FGGNLSMEGH ELYVPPLENV SIDYNQNVEN GNYVERSNHH LNNNNLNNMS  300
SLNSTSHNFN SSSNIKVENF GGIGNYWEGD ELKVGEWDLE ELMKDVSPFP FLDFQVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-252513222128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548901.10.0PREDICTED: transcription factor MYB46
TrEMBLA0A2G2YG470.0A0A2G2YG47_CAPAN; Transcription factor MYB32
STRINGPGSC0003DMT4000189950.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.17e-66myb domain protein 83