PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA00g65660 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 125aa MW: 14613.1 Da PI: 11.9812 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 82.2 | 8.9e-26 | 20 | 71 | 3 | 55 |
CBFB_NFYA 3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsg 55 p+YVNaKQy++IlkRRq ak ++++kl +k+rkpylh+SRh+hA++R Rg g CA00g65660 20 PIYVNAKQYSAILKRRQVHAKRQDQNKL-IKNRKPYLHKSRHRHAMKRSRGFG 71 9***************************.**********************77 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.2E-26 | 16 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 29.624 | 17 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-18 | 20 | 42 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.5E-21 | 20 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-18 | 51 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MVGVTTTRVA LPLECIEIFP IYVNAKQYSA ILKRRQVHAK RQDQNKLIKN RKPYLHKSRH 60 RHAMKRSRGF GECFLNTKNM RQSKPSSPKH DRNIFNRQAG VLALAIRDSL TIHPWILRGD 120 RRTW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-16 | 20 | 79 | 4 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 58 | 67 | RHRHAMKRSR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ865409 | 1e-125 | KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome. | |||
GenBank | KJ865410 | 1e-125 | KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | YP_009049690.1 | 2e-56 | hypothetical protein (mitochondrion) | ||||
Swissprot | Q9LNP6 | 1e-25 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A2G2Y705 | 8e-88 | A0A2G2Y705_CAPAN; Uncharacterized protein | ||||
STRING | PGSC0003DMT400055982 | 2e-53 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4800 | 20 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17590.4 | 5e-28 | nuclear factor Y, subunit A8 |
Publications ? help Back to Top | |||
---|---|---|---|
|