PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g64840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 418aa    MW: 46456.6 Da    PI: 8.8949
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g64840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.8e-174390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l ++v+++G g+W+++ r  g+ R++k+c++rw ++l
       CA00g64840 43 KGPWTTTEDTILMEYVRKHGEGNWNAVQRNSGLMRCGKSCRLRWANHL 90
                     79******************************************9986 PP

2Myb_DNA-binding48.32.2e-1596139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++++++++ G++ W++ a+ ++ gRt++++k++w++
       CA00g64840  96 KGAFSPEEERIIIELHAKIGNK-WARMAAQLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2353890IPR017930Myb domain
SuperFamilySSF466892.13E-2942137IPR009057Homeodomain-like
SMARTSM007172.9E-124292IPR001005SANT/Myb domain
PfamPF002499.6E-154390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-234497IPR009057Homeodomain-like
CDDcd001672.96E-104590No hitNo description
PROSITE profilePS5129425.53691145IPR017930Myb domain
SMARTSM007171.4E-1595143IPR001005SANT/Myb domain
PfamPF002491.3E-1496139IPR001005SANT/Myb domain
CDDcd001673.76E-1198141No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2598144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MNIYDLSFFF YFAGKKEGLM ATNDRGMKNS GGKNGGNRQV VKKGPWTTTE DTILMEYVRK  60
HGEGNWNAVQ RNSGLMRCGK SCRLRWANHL RPNLKKGAFS PEEERIIIEL HAKIGNKWAR  120
MAAQLPGRTD NEIKNYWNTR LKRRQRANLP IYPQELQSQN QPEHNQAQQS LISSAFDPQR  180
TTYNNPPSLS LLGILNPSSM RPPITHQFPL NGNKNFRNPP KGLSMTPPSS MQNSQFSSLP  240
VSVSNNNFGH DLFNSTPMPS FQQTYPDFSS TMRPFLGNIP SNQNGLMFDM GINSINYPSG  300
QLSMPVTTSS SSENTSSGFG SSDANNYTNV GGLSRGNSGL LEDLLEESQT LTRAMKIEER  360
GKSLWENYGL VEKELGDHQD GAIFTEESVY SFAHGDDVTL YNNSESSSSN PNASPGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30431447107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579400.10.0PREDICTED: myb-related protein 306-like
TrEMBLA0A1U8H7T70.0A0A1U8H7T7_CAPAN; Myb-related protein
TrEMBLA0A2G2Z3880.0A0A2G2Z388_CAPAN; myb-related protein 306-like
STRINGXP_009592281.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.17e-76myb domain protein 101