PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g59350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 174aa    MW: 19990.8 Da    PI: 9.6556
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g59350genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++++G g+W+  ++  g+ R++k+c++rw +yl
       CA00g59350 14 KGSWSKQEDQKLIDYITKHGEGCWRDLPKAAGLLRCGKSCRLRWMNYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding57.62.9e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       CA00g59350  67 RGNFSEDEDDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.254961IPR017930Myb domain
SuperFamilySSF466897.75E-3012108IPR009057Homeodomain-like
SMARTSM007177.9E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-231568IPR009057Homeodomain-like
CDDcd001674.42E-101661No hitNo description
PROSITE profilePS5129428.2262116IPR017930Myb domain
SMARTSM007171.8E-1766114IPR001005SANT/Myb domain
PfamPF002497.2E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2869117IPR009057Homeodomain-like
CDDcd001674.36E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MRKPGCDNKE EMHKGSWSKQ EDQKLIDYIT KHGEGCWRDL PKAAGLLRCG KSCRLRWMNY  60
LNPNLKRGNF SEDEDDLIIK LHALLGNRWS LIAGRLPGRT DNEVKNYWNS HLRRKLIKMG  120
IDPKNHNISH YLRIKRLEYF QENGIKSENN AVISDATSSN CVTSSLPDLN SLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-331111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9850231e-123KF985023.1 Petunia x hybrida cultivar Mitchell R2R3-MYB anthocyanin repressor (MYB27) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016553378.11e-125PREDICTED: transcription factor MYB3-like
SwissprotQ9S9K92e-67MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A2G2VKH01e-124A0A2G2VKH0_CAPBA; Transcription repressor MYB4
STRINGPGSC0003DMT4000784771e-108(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.17e-70myb domain protein 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  3. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  4. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  5. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  6. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  7. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]