PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bv9_223840_krez.t1

Organism

Beta vulgaris

Taxonomic ID

161934

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta

Family

MYB

Protein Properties

Length: 253aa MW: 28617.1 Da PI: 6.1119

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bv9_223840_krez.t1	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	63.6	3.9e-20	7	52	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEdell ++v+++G ++W+ I++ ++ gR++k+c++rw + Bv9_223840_krez.t1 7 KGPWSPEEDELLQKLVQKHGARNWSVISKSIP-GRSGKSCRLRWCNQ 52 79****************************.*********985 PP
2	Myb_DNA-binding	61.3	2e-19	61	103	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++teEde++v+a++q+G++ W+tI+r ++ gRt++ +k++w++ Bv9_223840_krez.t1 61 PFSTEEDEIIVRAHAQHGNK-WATISRLLN-GRTDNAIKNHWNST 103 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.821	2	57	IPR017930	Myb domain
SuperFamily	SSF46689	2.82E-32	4	100	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-17	6	55	IPR001005	SANT/Myb domain
Pfam	PF00249	9.5E-20	7	52	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.1E-26	8	60	IPR009057	Homeodomain-like
CDD	cd00167	4.66E-16	9	51	No hit	No description
SMART	SM00717	2.0E-15	58	106	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.346	59	108	IPR017930	Myb domain
Pfam	PF00249	1.3E-15	61	103	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.7E-23	61	107	IPR009057	Homeodomain-like
CDD	cd00167	1.01E-11	61	104	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0010200	Biological Process	response to chitin
GO:0042742	Biological Process	defense response to bacterium
GO:0046686	Biological Process	response to cadmium ion
GO:0050832	Biological Process	defense response to fungus
GO:2000022	Biological Process	regulation of jasmonic acid mediated signaling pathway
GO:2000031	Biological Process	regulation of salicylic acid mediated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 253 aa Download sequence Send to blast
MAADRIKGPW SPEEDELLQK LVQKHGARNW SVISKSIPGR SGKSCRLRWC NQLSPEVEHR 60 PFSTEEDEII VRAHAQHGNK WATISRLLNG RTDNAIKNHW NSTLKRKFSS IVAGDEIYRP 120 EKRPEISFSP PLSPSESDVS DSGVGYLPTV VEERENQEND PLTALTLSLP GIIEEHPSKS 180 ESTQEETRKV DVVGCESVKE TMSFGPELMA VMQEMIKKEV RNYMMEAERS GVSFDEYSAR 240 NAVVNRFCNG HIH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	2e-39	6	108	3	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	1e-38	6	108	57	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	1e-38	6	108	57	159	MYB PROTO-ONCOGENE PROTEIN
1mse_C	2e-39	6	108	3	105	C-Myb DNA-Binding Domain
1msf_C	2e-39	6	108	3	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00596	DAP	Transfer from AT5G67300	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010691674.1	0.0	PREDICTED: transcription factor MYB44-like
Swissprot	Q9FDW1	4e-76	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0K9R8X8	1e-146	A0A0K9R8X8_SPIOL; Uncharacterized protein
STRING	XP_010691674.1	0.0	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	2e-78	myb domain protein r1

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]