PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_209290_ninc.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family VOZ
Protein Properties Length: 557aa    MW: 62945 Da    PI: 5.7518
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_209290_ninc.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ395.51.2e-1212875041217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         pppsaflgp calwdc+rp+q se +++ycs+fha+la++e +pgt+p+lrp+gi+lkdg+lfaal++kv+gk+vgipec gaatakspwn
  Bv9_209290_ninc.t1 287 PPPSAFLGPICALWDCARPTQVSEFCKNYCSKFHADLAVEECPPGTSPILRPGGIGLKDGPLFAALRSKVEGKNVGIPECLGAATAKSPWN 377
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+elfd+s+lege +rewlffdkprrafe+g rkqrslpd++grgwhesrkq+mke++g+krsyy dpqp++ +ewhl+eyei+++da+al
  Bv9_209290_ninc.t1 378 APELFDFSILEGEKVREWLFFDKPRRAFETGTRKQRSLPDHEGRGWHESRKQIMKEYNGQKRSYYADPQPQKDLEWHLFEYEIDNCDACAL 468
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvde.kksakgkvskdsladlqkklgrlta 217
                         yrlelk+++e kks+k+kv++dsl dlqk++grlta
  Bv9_209290_ninc.t1 469 YRLELKVAEEkKKSPKTKVTNDSLIDLQKQMGRLTA 504
                         ******997626799*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MGKDSKNCKQ PSHKLLKDQA KNRVEDLQSM LNELHLARKD SRAVDVATLE EQLNQILREW  60
KAELDEPTPA SSLLEDSLGS FSKELGQLLQ QFEVEDDATS PLTAAPPIMR HDNATRTHAL  120
ADSGRDDEVC YLNHTNQQQS FQDYQNHTPQ QHKFLGSENH TLQQHQFQGF ASHLSQYDFP  180
GFDNHTPQHH ELIQFENRTS ESQDYQGFEH CNGVAAPVQG RMINNFEASG PHNMVANNFN  240
MTSQLEFIHL DKHQNLENEI FINASGIEHW GMDDLSDFSG VLPNVNPPPS AFLGPICALW  300
DCARPTQVSE FCKNYCSKFH ADLAVEECPP GTSPILRPGG IGLKDGPLFA ALRSKVEGKN  360
VGIPECLGAA TAKSPWNAPE LFDFSILEGE KVREWLFFDK PRRAFETGTR KQRSLPDHEG  420
RGWHESRKQI MKEYNGQKRS YYADPQPQKD LEWHLFEYEI DNCDACALYR LELKVAEEKK  480
KSPKTKVTND SLIDLQKQMG RLTAEVSAEN KRSGKGKSKI DLKKSDHGKD LAPTFTSVTS  540
GPDNLSEIQF TDNQKDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010689762.10.0PREDICTED: transcription factor VOZ1
TrEMBLA0A0K9S0440.0A0A0K9S044_SPIOL; Uncharacterized protein
STRINGXP_010689762.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.11e-122vascular plant one zinc finger protein 2