PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv8_182380_cpjk.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family VOZ
Protein Properties Length: 485aa    MW: 54287 Da    PI: 5.538
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv8_182380_cpjk.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ440.32.4e-1352084241217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         ppp+aflgpkcalwdc+rpaqgs+w+qdycssfha+lalneg+pg++pvlrp+gi+lkdgllfaalsakvqgk+vgipecegaatakspwn
  Bv8_182380_cpjk.t1 208 PPPAAFLGPKCALWDCPRPAQGSDWWQDYCSSFHASLALNEGPPGMSPVLRPGGIGLKDGLLFAALSAKVQGKDVGIPECEGAATAKSPWN 298
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+elfdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm ef+glkrsyymdpqp++++ewhlyeyein++d +al
  Bv8_182380_cpjk.t1 299 APELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMDEFSGLKRSYYMDPQPLNNYEWHLYEYEINKCDVCAL 389
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvdekksakgkvskdsladlqkklgrlta 217
                         yrlelklvd kk+++gk ++ds+++lqk++grl+a
  Bv8_182380_cpjk.t1 390 YRLELKLVDRKKTPRGKTANDSVSELQKQMGRLSA 424
                         *********************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MRKGLKRNGC KSVSHQLFKD RAKNRVDDLQ MIFSDLQSAR KDSRTVDAAV LEEQVYLMLR  60
EWKSELNEPS PASSLQNDSL GTFSSDIYRL LHLCDEEDDA TSPFELPLPK PEPDVQKCQV  120
GDAIGFLEGP DIKPGSQEQN FSPVDQCKGA PGFRSSTATN LEMANQLDYN QYNLHLDLEN  180
HYFGGYNGVD VGALYANPIS GFMPNVCPPP AAFLGPKCAL WDCPRPAQGS DWWQDYCSSF  240
HASLALNEGP PGMSPVLRPG GIGLKDGLLF AALSAKVQGK DVGIPECEGA ATAKSPWNAP  300
ELFDLSVLEG ETIREWLFFD KPRRAFESGN RKQRSLPDYS GRGWHESRKQ VMDEFSGLKR  360
SYYMDPQPLN NYEWHLYEYE INKCDVCALY RLELKLVDRK KTPRGKTAND SVSELQKQMG  420
RLSAEFPLDG RRPLKGRTKF NSKDGVGNLH SDPTQLITAD KTSFDHGVGA PYGYLVENLG  480
DYYLK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686387.10.0PREDICTED: transcription factor VOZ1
RefseqXP_019106652.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0K9QIS60.0A0A0K9QIS6_SPIOL; Uncharacterized protein
STRINGXP_010686387.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]