PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.8705s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 305aa    MW: 33374.6 Da    PI: 7.6893
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.8705s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.92.1e-08546439
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         r C+ +++  ++lfC+ +  +lC  C  ++H        H++
  Bostr.8705s0012.1.p  5 RLCDSCKSTAATLFCRADAAFLCGHCDGKIHTAnklasrHER 46
                         78******99*********************55666767765 PP

2zf-B_box26.31.6e-084792342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          + C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  Bostr.8705s0012.1.p 47 VWLCEVCEQAPAHVTCKADAAALCITCDRDIHSAnplsrrHERVPI 92
                         689*****************************66899999*99997 PP

3CCT69.68.2e-24236279144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  Bostr.8705s0012.1.p 236 REARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 279
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-13249IPR000315B-box-type zinc finger
PROSITE profilePS5011910.552249IPR000315B-box-type zinc finger
PfamPF006433.3E-6546IPR000315B-box-type zinc finger
CDDcd000211.84E-7549No hitNo description
PROSITE profilePS5011910.954592IPR000315B-box-type zinc finger
PfamPF006438.4E-74792IPR000315B-box-type zinc finger
CDDcd000214.17E-94892No hitNo description
SMARTSM003365.5E-105092IPR000315B-box-type zinc finger
PfamPF062031.3E-17236278IPR010402CCT domain
PROSITE profilePS5101716.658236278IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MASSRLCDSC KSTAATLFCR ADAAFLCGHC DGKIHTANKL ASRHERVWLC EVCEQAPAHV  60
TCKADAAALC ITCDRDIHSA NPLSRRHERV PITPFYDAVS GSVKSASSSV NVVDEDGGDV  120
SVEAASWLLP KEGVEISNLF SDLEYPKMEV TSENSSGNDG VVPVQKKMFL HEDYFNFDLS  180
ASKVSQHGFN FTNQPVSSRS LDVALVPEGG GATAEMSYTT TMTTATPALQ LSPAEREARV  240
LRYREKRKNR KFEKTIRYAS RKAYAEMRPR IKGRFAKRTD SRGNDGGDVG VYGEFGVVPV  300
KETW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.8705s0012.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180052.11e-178CONSTANS-like 3
SwissprotQ9SK531e-179COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A178VTY81e-176A0A178VTY8_ARATH; COL3
STRINGBostr.8705s0012.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-158CONSTANS-like 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Tripathi P,Carvallo M,Hamilton EE,Preuss S,Kay SA
    Arabidopsis B-BOX32 interacts with CONSTANS-LIKE3 to regulate flowering.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. 172-177
    [PMID:27999181]