PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7365s0058.2.p
Organism
Boechera stricta
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family MYB_related
Protein Properties Length: 77aa    MW: 9022.24 Da    PI: 5.7375
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7365s0058.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.71.8e-103170344
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                         ++++eE++l  + +k+ G + W++Ia +++ gRt++++  +w
  Bostr.7365s0058.2.p 31 NMSQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAEEIERFW 70
                         689***************99.*********.*********99 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.0E-82876IPR001005SANT/Myb domain
CDDcd001678.65E-73170No hitNo description
PfamPF002492.8E-93171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-113271IPR009057Homeodomain-like
PROSITE profilePS500906.1563370IPR017877Myb-like domain
SuperFamilySSF466896.08E-83371IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010026Biological Processtrichome differentiation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MDNHRRTKQP KTNSIVTYSS EVSSLEWEVV NMSQEEEDLV CRMHKLVGDR WELIAGRIPG  60
RTAEEIERFW VMKTEK*
Functional Description ? help Back to Top
Source Description
UniProtMYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.7365s0058.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195221e-91AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010422764.13e-47PREDICTED: MYB-like transcription factor ETC3 isoform X2
RefseqXP_010456209.13e-47PREDICTED: MYB-like transcription factor ETC3 isoform X2
SwissprotQ9M1572e-35ETC3_ARATH; MYB-like transcription factor ETC3
TrEMBLD7M4Z53e-43D7M4Z5_ARALL; Myb family transcription factor
TrEMBLF4JHR92e-43F4JHR9_ARATH; CAPRICE-like MYB3
STRINGBostr.7365s0058.1.p6e-48(Boechera stricta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.24e-38CAPRICE-like MYB3
Publications ? help Back to Top
  1. Koiwa H, et al.
    C-terminal domain phosphatase-like family members (AtCPLs) differentially regulate Arabidopsis thaliana abiotic stress signaling, growth, and development.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10893-8
    [PMID:12149434]
  2. Nemie-Feyissa D,Olafsdottir SM,Heidari B,Lillo C
    Nitrogen depletion and small R3-MYB transcription factors affecting anthocyanin accumulation in Arabidopsis leaves.
    Phytochemistry, 2014. 98: p. 34-40
    [PMID:24388610]
  3. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  4. Tominaga-Wada R,Wada T
    The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2016. 199: p. 111-115
    [PMID:27302012]
  5. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  6. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  7. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]