PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.7365s0058.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 78aa MW: 9151.35 Da PI: 5.1817 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.6 | 1.9e-10 | 32 | 71 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++eE++l + +k+ G + W++Ia +++ gRt++++ +w Bostr.7365s0058.1.p 32 NMSQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAEEIERFW 71 689***************99.*********.*********99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 8.0E-8 | 29 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-9 | 32 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.07E-6 | 32 | 71 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-11 | 33 | 72 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.08E-8 | 34 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.156 | 34 | 71 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MDNHRRTKQP KTNSIVTYSS EEVSSLEWEV VNMSQEEEDL VCRMHKLVGD RWELIAGRIP 60 GRTAEEIERF WVMKTEK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.7365s0058.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519522 | 1e-100 | AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010422764.1 | 2e-45 | PREDICTED: MYB-like transcription factor ETC3 isoform X2 | ||||
Refseq | XP_010456209.1 | 2e-45 | PREDICTED: MYB-like transcription factor ETC3 isoform X2 | ||||
Swissprot | Q9M157 | 4e-37 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
TrEMBL | D7M4Z5 | 6e-44 | D7M4Z5_ARALL; Myb family transcription factor | ||||
STRING | Bostr.7365s0058.1.p | 3e-50 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.3 | 2e-37 | CAPRICE-like MYB3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.7365s0058.1.p |