PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.7200s0031.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 116aa MW: 12984.8 Da PI: 11.364 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 63 | 6e-20 | 1 | 78 | 120 | 201 |
GRAS 120 sqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201 +qGlQW+aL++ Las p++ s+RiTg+gs s+e l +tg+rLa+f ++l+++fef+++ k + +e+++L +++gE+ Bostr.7200s0031.1.p 1 MQGLQWAALFHILASHPRKLRSIRITGFGS----SSELLASTGRRLADFSSALNLSFEFHPVEGKIRNLIEPSQLGTRQGEV 78 69****************************....99*************************877777778*********996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 14.117 | 1 | 115 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.0E-17 | 1 | 78 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MQGLQWAALF HILASHPRKL RSIRITGFGS SSELLASTGR RLADFSSALN LSFEFHPVEG 60 KIRNLIEPSQ LGTRQGEVRG HARTFVSYRQ TKCNSFVSYR HLSHHFSVVD FLVSV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 2e-17 | 1 | 78 | 138 | 214 | Protein SCARECROW |
5b3h_A | 2e-17 | 1 | 78 | 137 | 213 | Protein SCARECROW |
5b3h_D | 2e-17 | 1 | 78 | 137 | 213 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.7200s0031.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB017067 | 3e-81 | AB017067.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJC20. | |||
GenBank | BT029760 | 3e-81 | BT029760.1 Arabidopsis thaliana At5g41920 mRNA, complete cds. | |||
GenBank | CP002688 | 3e-81 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010441372.1 | 5e-41 | PREDICTED: scarecrow-like protein 23 | ||||
Refseq | XP_010448131.1 | 4e-41 | PREDICTED: scarecrow-like protein 23 | ||||
Swissprot | Q9FHZ1 | 1e-39 | SCL23_ARATH; Scarecrow-like protein 23 | ||||
TrEMBL | C0JEQ0 | 2e-41 | C0JEQ0_9BRAS; At5g41920-like protein (Fragment) | ||||
TrEMBL | C0JER3 | 2e-41 | C0JER3_9BRAS; At5g41920-like protein (Fragment) | ||||
TrEMBL | C0JER7 | 2e-41 | C0JER7_9BRAS; At5g41920-like protein (Fragment) | ||||
STRING | Bostr.7200s0031.1.p | 9e-79 | (Boechera stricta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41920.1 | 5e-42 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.7200s0031.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|