PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.7200s0005.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 220aa MW: 24973.4 Da PI: 8.7998 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.1 | 1.9e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl Bostr.7200s0005.1.p 14 KGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 61 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 60.3 | 4.3e-19 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l Bostr.7200s0005.1.p 67 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.72 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.88E-31 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.9E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.1E-25 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.53E-12 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.765 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-18 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.9E-18 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-27 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.33E-14 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010053 | Biological Process | root epidermal cell differentiation | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MRMTRDGKEH EYKKGLWTVE EDKILMDYVR THGQGHWNRI AKKTGLKRCG KSCRLRWMNY 60 LSPDVNRGNF TDQEEDLIIR LHKLLGNRWS LIAKRVPGRT DNQVKNYWNT HLSKKLGLGD 120 HSSGAKPASD AESPPSLALI TTTSSSHQEI AGEKVSTVRF DTLVDESKLK PKPKPIHSLP 180 TDVEVAATVP NLFDTFWVLE DDFELSSLTM MDFTNGYCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-28 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00538 | DAP | Transfer from AT5G40330 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.7200s0005.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519631 | 0.0 | AY519631.1 Arabidopsis thaliana MYB transcription factor (At5g40330) mRNA, complete cds. | |||
GenBank | BT025285 | 0.0 | BT025285.1 Arabidopsis thaliana At5g40330 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006282714.1 | 1e-160 | transcription factor MYB23 | ||||
Swissprot | Q96276 | 1e-152 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | R0F1W9 | 1e-158 | R0F1W9_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.7200s0005.1.p | 1e-163 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 1e-154 | myb domain protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.7200s0005.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|