PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.6864s0195.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 112aa MW: 12926.2 Da PI: 4.7238 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 81.3 | 1.5e-25 | 4 | 98 | 3 | 97 |
DUF260 3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +aCk r kC ++Cv+ py+ a++p+k+an+ +F s + k+l ++++++r++ +++l++ Aear+rdPv G++g+i lq+qle l+ l Bostr.6864s0195.1.p 4 CACKDARHKCIEECVFVPYLLANKPEKYANLSTVFDISFLAKFLMDIEPSQRQTCVDTLCFDAEARLRDPVMGSTGLICLLQRQLEDLELLL 95 48************************************************************************************998766 PP DUF260 95 all 97 + + Bostr.6864s0195.1.p 96 KIA 98 665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 16.879 | 1 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.1E-26 | 5 | 97 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MEPCACKDAR HKCIEECVFV PYLLANKPEK YANLSTVFDI SFLAKFLMDI EPSQRQTCVD 60 TLCFDAEARL RDPVMGSTGL ICLLQRQLED LELLLKIAKR DYMVILQEIH EQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 8e-24 | 3 | 103 | 11 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 8e-24 | 3 | 103 | 11 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.6864s0195.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019101899.1 | 6e-44 | PREDICTED: LOB domain-containing protein 6-like | ||||
TrEMBL | R0H7D0 | 1e-43 | R0H7D0_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.6864s0195.1.p | 4e-77 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 1e-22 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.6864s0195.1.p |