PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.3288s0031.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 405aa    MW: 45473.9 Da    PI: 4.7236
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.3288s0031.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.92.1e-081963340
             zf-B_box  3 erkCpeHee.kelqlfCedCqqllCedClleeHkg......Htvv 40
                         +r C+ + +  +++++C  ++ +lC++C  ++H+       H++v
  Bostr.3288s0031.1.p 19 ARACDACMKrSRASWYCPADDAFLCQSCDASIHSAnnlakrHERV 63
                         578*****9556*********************657788888876 PP

2CCT68.91.3e-23357400144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Bostr.3288s0031.1.p 357 REARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKRT 400
                          9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.4E-111765IPR000315B-box-type zinc finger
PROSITE profilePS501199.8691765IPR000315B-box-type zinc finger
PfamPF006431.1E-62063IPR000315B-box-type zinc finger
CDDcd000211.63E-92065No hitNo description
PROSITE profilePS5101716.202357399IPR010402CCT domain
PfamPF062036.2E-18357399IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0010223Biological Processsecondary shoot formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MVVDVESRAA SVTGGKTAAR ACDACMKRSR ASWYCPADDA FLCQSCDASI HSANNLAKRH  60
ERVRLQSSSS PELLMKTKTA DKTTSVWYEG FRRKARTPRN KLLPIEDLNN SNDPLVPELG  120
VEEEDGFFSF SSKDENEESL NCCVPVFVPF SDMVIDDNSF GLVPDGVNIT TSSGDLGEIE  180
RAVMDDEGLI EFLPLDMDLE ELTMDVERLL EEEELCLGVK EPNDIGLVKE ETNVGFKINC  240
KDLKRVKDEE QEEEEAKCEH GGSRDSDREA YEDEDRKTSL FLRLDYEAVI SAWDNHGSPW  300
KTGIKPEFNL GDCRRECLLG GNTCPSHVMG GFEELASTVG SVTRQQGKDG GGSDGEREAR  360
VLRYREKRRT RLFAKKIRYE VRKLNAEQRP RIKGRFVKRT SLLT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1367383RRTRLFAKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.3288s0031.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302335.10.0zinc finger protein CONSTANS-LIKE 7
SwissprotQ9C9A90.0COL7_ARATH; Zinc finger protein CONSTANS-LIKE 7
TrEMBLR0IES10.0R0IES1_9BRAS; Uncharacterized protein
STRINGBostr.3288s0031.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1750679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73870.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]