PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.30275s0426.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CAMTA
Protein Properties Length: 447aa    MW: 51762.1 Da    PI: 7.0662
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.30275s0426.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-176.53.5e-24399759117
                  CG-1  59 kkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117
                            kkd +++ E++e+LKvg+ e+l+cyYa++e++ptfqrr+yw+L+ e+ +ivlvhy++v
  Bostr.30275s0426.1.p  39 EKKDSRAIAEAYERLKVGNAEALSCYYARGEHDPTFQRRIYWMLDPEYGHIVLVHYRDV 97 
                           59*******************************************************97 PP

2B353.25.3e-17196298199
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+  l+++dv + + +++p++ a+++        g+ e+   +++ede+g+ W + +++ +  +r+ +t+GW+++vk+++L +gD+v F
  Bostr.30275s0426.1.p 196 FEMRLKTKDVDNVDFIIIPNEDARNYfpfinfqRGP-ES--FIRFEDEDGKGWLFGYSHHNIWSRCEFTRGWSRYVKEKQLSAGDSVFF 281
                           56678999***************999****985444.34..5***************9988888999********************** PP

                           EE-SSSEE..EEEEE-S CS
                    B3  83 kldgrsefelvvkvfrk 99 
                           ++++ ++ +l+++ +r+
  Bostr.30275s0426.1.p 282 QRHHIDSSKLFIGCRRR 298
                           *7766888899998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143731.8091103IPR005559CG-1 DNA-binding domain
SMARTSM010761.8E-14698IPR005559CG-1 DNA-binding domain
PfamPF038591.1E-193997IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.40.330.109.6E-21192300IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-16195300IPR015300DNA-binding pseudobarrel domain
CDDcd100172.63E-13195297No hitNo description
PROSITE profilePS5086310.715196299IPR003340B3 DNA binding domain
SMARTSM010199.2E-5196298IPR003340B3 DNA binding domain
PfamPF023628.0E-15196298IPR003340B3 DNA binding domain
PfamPF015824.0E-6363445IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF522003.53E-8366445IPR000157Toll/interleukin-1 receptor homology (TIR) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MKDGRLHIRL LKGLQVGLYF FSIKRFYDSS VKMAINGGEK KDSRAIAEAY ERLKVGNAEA  60
LSCYYARGEH DPTFQRRIYW MLDPEYGHIV LVHYRDVSDR EEVTSPISHI CSGSGTRSAS  120
MAENLKPQML APSDKVEAIV RSVSGDTFKR IFGSHKENPF DSQIVRTFLM ELAEERTSQK  180
ESVKKMLSHT YKEDLFEMRL KTKDVDNVDF IIIPNEDARN YFPFINFQRG PESFIRFEDE  240
DGKGWLFGYS HHNIWSRCEF TRGWSRYVKE KQLSAGDSVF FQRHHIDSSK LFIGCRRRCR  300
VIRKEIDAGA APANDAHESP TTSEMLELRE KLEEVEIHFQ QGLHEHTITG FDPILVISCG  360
INQDSEETYF ISCIYNELCL CGFTPCRYDL TRSTMTENPD MLYRSRVCIM IITMNYARFR  420
ECLVEFTAIK VHLKANNVVL LPVFLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A3e-1619329811117DNA-binding protein RAV1
5os9_A2e-161923014116B3 domain-containing transcription factor NGA1
5os9_B2e-161923014116B3 domain-containing transcription factor NGA1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.30275s0426.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5100268e-94AY510026.1 Arabidopsis thaliana ethylene-induced calmodulin-binding protein 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019087970.10.0PREDICTED: disease resistance protein RRS1-like
TrEMBLA0A1J3F4T33e-86A0A1J3F4T3_NOCCA; Putative WRKY transcription factor 19
TrEMBLA0A1J3HY473e-86A0A1J3HY47_NOCCA; Putative WRKY transcription factor 19
STRINGBostr.30275s0426.1.p0.0(Boechera stricta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.12e-30Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains