PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.26833s0577.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 232aa MW: 25192.6 Da PI: 10.2254 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 38.9 | 1.9e-12 | 91 | 136 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+ ++ + ++lG+g+W+ I+r + ++++ q+ s+ qky Bostr.26833s0577.1.p 91 LPWTEEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKY 136 69*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50158 | 8.532 | 3 | 18 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 18.248 | 84 | 141 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.54E-16 | 87 | 141 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.9E-18 | 88 | 140 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.3E-8 | 89 | 139 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-9 | 91 | 135 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.5E-10 | 92 | 136 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.14E-8 | 92 | 137 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MGRRCSHCGN VGHNSRTCSS NHTRVIRLFG VHLDTTSSSP PPPSPPSILA AAMKKSFSMD 60 CLPACSSSSS SFAGYLSDGL AHKTPDRKKG LPWTEEEHRT FLIGLEKLGK GDWRGISRNF 120 VVTKSPTQVA SHAQKYFLRQ TTTLHHKRRR TSLFDMVSAV KVEENSTTKN ICNEHTGSTS 180 KVVWKQGLLN PCLGYQDPKV SGSGNSGGLD LELKLASIQS PESNIRPISV T* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00565 | DAP | Transfer from AT5G56840 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.26833s0577.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519517 | 0.0 | AY519517.1 Arabidopsis thaliana MYB transcription factor (At5g56840) mRNA, complete cds. | |||
GenBank | BT012528 | 0.0 | BT012528.1 Arabidopsis thaliana At5g56840 gene, complete cds. | |||
GenBank | BT014956 | 0.0 | BT014956.1 Arabidopsis thaliana At5g56840 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010451524.1 | 1e-148 | PREDICTED: uncharacterized protein LOC104733656 | ||||
Swissprot | Q7XC57 | 3e-46 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | R0EY53 | 1e-139 | R0EY53_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.26833s0577.1.p | 1e-171 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5496 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56840.1 | 1e-138 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.26833s0577.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|