PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0489.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 362aa    MW: 39786.5 Da    PI: 6.4997
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0489.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.23.4e-081957339
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htv 39
                          +r C+ +++  +  fC+ ++ +lC +C +++H+   H++
  Bostr.26833s0489.1.p 19 ARSCDACKSVTADVFCRVDSAFLCITCDTKIHSFtrHER 57
                          578******99*********************6577876 PP

2zf-B_box28.14.3e-0958103342
              zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                            ++C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  Bostr.26833s0489.1.p  58 VWVCEVCEQAPAAVTCKADAAALCVTCDSDIHSAnplasrHERVPV 103
                           689*****************************66999999999986 PP

3CCT706.2e-24293336144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Bostr.26833s0489.1.p 293 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 336
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.1821760IPR000315B-box-type zinc finger
SMARTSM003361.2E-61760IPR000315B-box-type zinc finger
PfamPF006439.5E-72058IPR000315B-box-type zinc finger
CDDcd000218.25E-82060No hitNo description
PROSITE profilePS5011910.72256103IPR000315B-box-type zinc finger
PfamPF006434.5E-757103IPR000315B-box-type zinc finger
CDDcd000211.05E-859103No hitNo description
SMARTSM003364.6E-1061103IPR000315B-box-type zinc finger
PROSITE profilePS5101716.817293335IPR010402CCT domain
PfamPF062035.6E-18293335IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGFGLESIKS ISGEWGVAAR SCDACKSVTA DVFCRVDSAF LCITCDTKIH SFTRHERVWV  60
CEVCEQAPAA VTCKADAAAL CVTCDSDIHS ANPLASRHER VPVESFFGSA VAKISASSTF  120
GILGSSTTVD LTAVPVMSDD LGLCPWLLPN NFNEPAKIEI GTENMKSSDF MFSDFDRLID  180
FEFQNSLNHH QPSHTNNAGA DSLVPVQTKT EPIPLTNNDH CFDIDFCRSK LSAFTYPTQS  240
VSHSISTSSL EYGVVPDRNT NNSVSEISIP FNRSAITSST AATTSDQTSS MDREARVLRY  300
REKRKNRKFE KTIRYASRKA YAESRPRIKG RFAKRTETEN DDIFLSHVYA SAAQYGVVPT  360
F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.26833s0489.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0884320.0AY088432.1 Arabidopsis thaliana clone 6639 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280689.10.0zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLR0EWL40.0R0EWL4_9BRAS; Uncharacterized protein
STRINGBostr.26833s0489.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]