PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26675s0264.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 324aa    MW: 37716.1 Da    PI: 5.9836
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26675s0264.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.56.5e-091758237
              zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                          ++r C+++ +k++ ++C +++ +lC+ C ++ H+       H
  Bostr.26675s0264.1.p 17 QPRACDLCLNKHAVWYCASDDAFLCHVCDESVHSAnhvatkH 58
                          7899*****************************657555555 PP

2CCT67.15e-23275318144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea++ +Y++Krk+R+FeKkirYe+RK++A++RpR+KGrFv+++
  Bostr.26675s0264.1.p 275 REAKVWKYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS 318
                           9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.5E-111663IPR000315B-box-type zinc finger
PROSITE profilePS5011910.1391663IPR000315B-box-type zinc finger
PfamPF006431.5E-71760IPR000315B-box-type zinc finger
CDDcd000219.80E-111963No hitNo description
PfamPF062031.7E-17275317IPR010402CCT domain
PROSITE profilePS5101715.696275317IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MFCSEIMIRK YQEDVKQPRA CDLCLNKHAV WYCASDDAFL CHVCDESVHS ANHVATKHER  60
VFLRTNDVLQ GTTSNPVWHS GFRRKARTSR SRYEKKPPQK IDDERRREDP RVPEIGGEAM  120
FSIPEANDDD DMTSLVPEFE GFTEMGFFLS NHNGTEETTK QFNFEDEIDA MEDLYYNEEE  180
EAAKNNGAET CPGQSLMSCK KDYDNVIAIS AKTEESEDYE INAKQRNMLL RLNYESVIAA  240
WDKQESPREA ADNTSNFQLV PPGIEEKKMC NRSEREAKVW KYRDKRKNRL FEKKIRYEVR  300
KVNADKRPRM KGRFVRRSLA TDS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.26675s0264.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3173810.0AK317381.1 Arabidopsis thaliana AT1G49130 mRNA, complete cds, clone: RAFL25-23-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019091540.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X1
SwissprotQ9M9B30.0COL8_ARATH; Zinc finger protein CONSTANS-LIKE 8
TrEMBLA0A178WMU30.0A0A178WMU3_ARATH; BBX17
STRINGBostr.26675s0264.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150481517
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49130.21e-179B-box type zinc finger protein with CCT domain