PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0751.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 412aa    MW: 45434.7 Da    PI: 7.2638
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0751.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.54.2e-061149537
              zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                           C+ ++e  + lfC+ +   lC  C ++ H+       H
  Bostr.23794s0751.1.p 11 ACDFCNERTAVLFCRADTAKLCLLCDQHVHSAnllarkH 49
                          5******99*******************99555666666 PP

2zf-B_box21.93.8e-075294339
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                           ++C+++++++++  C++++  +C++C    H +      H++
  Bostr.23794s0751.1.p 52 SQICDNCSKEPVTVRCFTDNLVFCQECDWDVHGScssaaaHER 94
                          689************************9988844667777765 PP

3CCT63.85.2e-22366409144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           R+ a++RYkeK+ktR+++K+irYe+RKa+Ae+R RvKGrFvk++
  Bostr.23794s0751.1.p 366 RDIAMQRYKEKKKTRRYDKTIRYETRKARAETRLRVKGRFVKAT 409
                           7779**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-11754IPR000315B-box-type zinc finger
PROSITE profilePS501199.499754IPR000315B-box-type zinc finger
CDDcd000211.52E-81042No hitNo description
PROSITE profilePS501198.8735097IPR000315B-box-type zinc finger
CDDcd000215.06E-65483No hitNo description
SMARTSM003363.35597IPR000315B-box-type zinc finger
PROSITE profilePS5101714.664366408IPR010402CCT domain
PfamPF062032.2E-16366408IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGSSTTECVV ACDFCNERTA VLFCRADTAK LCLLCDQHVH SANLLARKHV RSQICDNCSK  60
EPVTVRCFTD NLVFCQECDW DVHGSCSSAA AHERSAVEGF SGCPSVSELA AVWGIDLEGK  120
KKEAEAGEDE LNEKFGMALD SCGSGSNIVQ DLIVPYDMSM KKRSFSLGRF KQAVYRQLEE  180
LLKRGFVSGE GDGGGEIMVR EGINGGVSIS QQSPTTSFTS LLLPTEYQSS CGNATQCDAA  240
NHTTGQNTQI WDFNLGQSRN PEEPSPVEPK SSTFTFNNVT HIKNDTHPTN VKTFRDTYQD  300
ESIHSNSTKG QETSKSNNIP AAIHSHKSSN DSGDLHFTEH AVIASTKTTR LVAATNADLE  360
RMAQKRDIAM QRYKEKKKTR RYDKTIRYET RKARAETRLR VKGRFVKATD P*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.23794s0751.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413852.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like isoform X2
SwissprotO228000.0COL14_ARATH; Zinc finger protein CONSTANS-LIKE 14
TrEMBLC0SV720.0C0SV72_ARATH; Uncharacterized protein At2g33500 (Fragment)
STRINGBostr.23794s0751.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.20.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]