PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.23794s0182.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 142aa MW: 15180.9 Da PI: 4.5966 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.4 | 3.7e-57 | 19 | 116 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 vreqdr+lPian+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfedy+eplk+yl++ Bostr.23794s0182.1.p 19 VREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLAR 107 69*************************************************************************************** PP NF-YB 90 yrelegekk 98 yreleg++k Bostr.23794s0182.1.p 108 YRELEGDNK 116 ******975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.7E-54 | 17 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-41 | 22 | 133 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-27 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-21 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-21 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 4.7E-21 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MADTPSSPAG DGGESGGSVR EQDRYLPIAN ISRIMKKALP PNGKIGKDAK DTVQECVSEF 60 ISFITSEASD KCQKEKRKTV NGDDLLWAMA TLGFEDYLEP LKIYLARYRE LEGDNKGSGK 120 SGDGSNRDAG GGVSGEEMPS W* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-48 | 18 | 110 | 1 | 93 | NF-YB |
4awl_B | 2e-48 | 18 | 110 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-48 | 18 | 110 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00300 | DAP | Transfer from AT2G38880 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.23794s0182.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY088554 | 0.0 | AY088554.1 Arabidopsis thaliana clone 7805 mRNA, complete sequence. | |||
GenBank | BT004266 | 0.0 | BT004266.1 Arabidopsis thaliana clone RAFL15-29-F19 (R20926) putative CCAAT-binding transcription factor subunit (At2g38880) mRNA, complete cds. | |||
GenBank | BT005536 | 0.0 | BT005536.1 Arabidopsis thaliana clone U20926 putative CCAAT-binding transcription factor subunit (At2g38880) mRNA, complete cds. | |||
GenBank | DQ333305 | 0.0 | DQ333305.1 Arabidopsis thaliana transcription factor subunit NF-YB1 mRNA, complete cds. | |||
GenBank | Y13723 | 0.0 | Y13723.1 Arabidopsis thaliana mRNA for Hap3a transcription factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001031511.1 | 1e-100 | nuclear factor Y, subunit B1 | ||||
Refseq | NP_030436.1 | 1e-100 | nuclear factor Y, subunit B1 | ||||
Refseq | NP_850304.2 | 1e-100 | nuclear factor Y, subunit B1 | ||||
Refseq | XP_002879771.1 | 1e-100 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q9SLG0 | 1e-101 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A6XB86 | 2e-98 | A6XB86_ARATH; Transcription factor subunit NF-YB1 | ||||
TrEMBL | D7LCC9 | 2e-98 | D7LCC9_ARALL; Uncharacterized protein | ||||
STRING | scaffold_402629.1 | 3e-99 | (Arabidopsis lyrata) | ||||
STRING | Bostr.23794s0182.1.p | 3e-99 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.5 | 5e-91 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.23794s0182.1.p |