PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.22252s0262.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 371aa    MW: 40701.1 Da    PI: 6.4061
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.22252s0262.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.61.9e-06444539
              zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                          +C+ ++e++   +C+++  +lC +C  + H+       H++
  Bostr.22252s0262.2.p  4 MCDFCSEQRSMVYCRSDAACLCLSCDRSVHSAnalskrHSR 44
                          6*****************************65677777765 PP

2zf-B_box23.98.5e-084695440
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.............Htvv 40
                           +C++++ ++++  C + ++ lC++C  ++H++             H+++
  Bostr.22252s0262.2.p 46 LVCERCNAQPATVRCVEERVSLCQNCDWSGHNNnnssssssspqqqHKRQ 95
                          68*****************************8877777777777777765 PP

3CCT60.46.1e-21313356144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  Bostr.22252s0262.2.p 313 RNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAG 356
                           99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.741147IPR000315B-box-type zinc finger
CDDcd000211.79E-6447No hitNo description
SMARTSM003361.2E-7447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7744389IPR000315B-box-type zinc finger
CDDcd000212.78E-54776No hitNo description
SMARTSM003361.24897IPR000315B-box-type zinc finger
PROSITE profilePS5101715.338313355IPR010402CCT domain
PfamPF062031.0E-15313355IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGYMCDFCSE QRSMVYCRSD AACLCLSCDR SVHSANALSK RHSRTLVCER CNAQPATVRC  60
VEERVSLCQN CDWSGHNNNN SSSSSSSPQQ QHKRQTISCY SGCPSSSELA SIWSFCLDLA  120
GQSICEQEMG MMNIDDNGPT HKNCNEDKKD VLIGSSSIPE SSSAALGSSS FAKKDVGVCE  180
DDFYGNLGMD EVDLALENYE ELFGVAFNPS EELFGHGGMD SLFQKHQTAP EGWNSVQPAG  240
SNDSFMSSKT EPIICFVSKP AHSNISFSGV TGESSPGDFQ ECGASSSMQL SGEPPWYPPA  300
SQENNACSHS VTRNNAVMRY KEKKKARKFD KRVRYASRKA RADVRRRVKG RFVKAGEAYD  360
YDPLTPTRSY *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.22252s0262.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3169340.0AK316934.1 Arabidopsis thaliana AT3G07650 mRNA, complete cds, clone: RAFL14-22-K23.
GenBankBT0294900.0BT029490.1 Arabidopsis thaliana At3g07650 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010486334.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLR0HZV40.0R0HZV4_9BRAS; Uncharacterized protein
STRINGBostr.22252s0262.1.p0.0(Boechera stricta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9