PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19424s0458.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 373aa    MW: 41042.3 Da    PI: 6.5637
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19424s0458.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.1e-07648339
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                          e+kC+++e  ++ ++C+++   lC +C ++ H+       Ht+
  Bostr.19424s0458.1.p  6 EPKCDHCETAQAVIYCKSDLAKLCLNCDVHVHSAnplshrHTR 48
                          89*******99********************966888855655 PP

2CCT59.61.1e-20315357143
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                           R++a+lRYkeKr +R F K+irY+sRKa+A++R+RvKGrFvk+
  Bostr.19424s0458.1.p 315 RNKAKLRYKEKRLKRSFGKQIRYASRKARADTRKRVKGRFVKA 357
                           899**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.93451IPR000315B-box-type zinc finger
SMARTSM003361.8E-10451IPR000315B-box-type zinc finger
PfamPF006431.1E-5648IPR000315B-box-type zinc finger
CDDcd000211.53E-6751No hitNo description
PROSITE profilePS5101714.485315357IPR010402CCT domain
PfamPF062032.9E-15315357IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MSPSMEPKCD HCETAQAVIY CKSDLAKLCL NCDVHVHSAN PLSHRHTRSL ICQKCFSQPA  60
VIRCLDEKYS YCQGCHLQAS NCSVLGHRLQ SLNPFSGCPS PTDFVRMWSS ILEPSVSGLV  120
SPFVGSLPLN DPSNAMFGMA KINELDGLIT SSYSTVPHNI SYTQNLSDQS SFFPVKSKGC  180
PDLVLKLDED EEDLCEGLIL DNAPLNFDVG DDIIGCSSEE HIEPDHTTTS PGQQDCASYQ  240
SGPLQMNINT TGLPLPLPPS PVLFGQIHPT MSLTISNITG ESSAADYQDR GISPGFIMSE  300
APWESNLEVR CPQARNKAKL RYKEKRLKRS FGKQIRYASR KARADTRKRV KGRFVKAVDN  360
YDYDPSSPSN NQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.19424s0458.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0007391e-155AP000739.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MEK6.
GenBankCP0026861e-155CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488213.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like isoform X1
SwissprotQ9LJ440.0COL12_ARATH; Zinc finger protein CONSTANS-LIKE 12
TrEMBLV4M5W20.0V4M5W2_EUTSA; Uncharacterized protein
STRINGBostr.19424s0458.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-178B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. OrdoƱez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]