PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.15774s0314.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 614aa    MW: 69390.9 Da    PI: 7.861
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.15774s0314.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B381.21e-25127228199
                           EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                           f k+lt sd++++g l++p+k+a+++     ++++  +++   +d++g++W +k+++r+k++r++lt+GW+ Fv a++L +gD++vF  
  Bostr.15774s0314.1.p 127 FTKILTASDTSTHGGLSIPRKHATNClppldMSIPIPTQEFLTKDLHGKEWGFKHSFRGKPRRHLLTTGWSAFVTAKRLVAGDVFVFL- 214
                           89*********************999****9445555568999*********************************************. PP

                           -SSSEE..EEEEE-S CS
                    B3  85 dgrsefelvvkvfrk 99 
                            + +++el+v+++r+
  Bostr.15774s0314.1.p 215 -RGETGELRVGIRRA 228
                           .449999*****996 PP

2Auxin_resp102.94.1e-34253332183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha++++++F+vvY+Pr+  s+Fvv+++k+++a+++k+ vG+Rf m+fe+ed+serr+sGt++gv+++++ +W++S+WrsL+
  Bostr.15774s0314.1.p 253 AMHAFDNQCMFTVVYKPRT--SQFVVSYDKFLDAMNNKFNVGSRFTMRFEGEDFSERRYSGTIIGVNNFSS-HWKDSEWRSLQ 332
                           789***************6..9**********************************************888.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.4E-38121240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.62E-31125234IPR015300DNA-binding pseudobarrel domain
CDDcd100174.03E-25126227No hitNo description
PROSITE profilePS5086313.916127229IPR003340B3 DNA binding domain
PfamPF023621.6E-23127228IPR003340B3 DNA binding domain
SMARTSM010192.2E-24127229IPR003340B3 DNA binding domain
PfamPF065077.3E-31253332IPR010525Auxin response factor
PfamPF023096.4E-7507554IPR033389AUX/IAA domain
SuperFamilySSF542773.68E-12514594No hitNo description
PROSITE profilePS5174524.619518599IPR000270PB1 domain
PfamPF023092.5E-6557602IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MESGNVVDAH PQELLGIIDG TKSYMYEQLW KLCAGPLCDL PKLGEKVYYF PQGHIELVKA  60
STREDLNEIQ PIFDLPSKLQ CRVIAIQLKT EKNTDEVYAE ISLMPDTTQV KVSTQNNNNY  120
RPIVNSFTKI LTASDTSTHG GLSIPRKHAT NCLPPLDMSI PIPTQEFLTK DLHGKEWGFK  180
HSFRGKPRRH LLTTGWSAFV TAKRLVAGDV FVFLRGETGE LRVGIRRAGH QEGNISSSLV  240
SMESMRHGVI ASAMHAFDNQ CMFTVVYKPR TSQFVVSYDK FLDAMNNKFN VGSRFTMRFE  300
GEDFSERRYS GTIIGVNNFS SHWKDSEWRS LQVQWDELAS FPRRDKVSPW EIEHLTPSSN  360
VLQSSLLKNK RSRHVNEIGS TSSHLLPPIL TQGQEIGQPS MTSPMSIPQL NYRDEIEDAK  420
TPSSLLMSYS VPTMPKSNYN NDQMVTPIKE NITTVAGASC RLFGVSLATP SYIKDPMEPN  480
DSNQISEFSK ISQEKKFDLT QTLTSPKEIQ SKQFSSTRSY TKVQMQGVTI GRALDLSVLN  540
GYDQLIRELE KLFDLKGLLR TRNQWEIVFT DNEGDMMLVG DDPWPEFRNM VKKIIICSKE  600
EVKNLKSGNN LSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1312535519355Auxin response factor 1
4ldw_A1e-1312535519355Auxin response factor 1
4ldw_B1e-1312535519355Auxin response factor 1
4ldx_A1e-1312535519355Auxin response factor 1
4ldx_B1e-1312535519355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.15774s0314.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478873.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGBostr.15774s0314.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14