PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.15774s0198.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 163aa MW: 17914 Da PI: 4.6457 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 170.1 | 2.6e-53 | 26 | 124 | 1 | 99 |
NF-YC 1 qlksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdif 89 q++++w++q+e+++dfkn++lPla+ikki+kad+dv+m+saeaP+l++kace fi++lt+rswlhaeenkr+tl+ksdi++av++++++ Bostr.15774s0198.1.p 26 QIRNYWIEQMENVSDFKNRQLPLAKIKKIMKADPDVHMVSAEAPILFAKACEKFIVDLTMRSWLHAEENKRHTLQKSDISDAVASSFTY 114 799************************************************************************************** PP NF-YC 90 dflvdivprd 99 dfl+d+vp+d Bostr.15774s0198.1.p 115 DFLLDVVPKD 124 ********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 9.73E-30 | 8 | 117 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 3.9E-32 | 36 | 108 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-18 | 45 | 108 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MENNNGNNQP PPSYSQPPQT ASSNPQIRNY WIEQMENVSD FKNRQLPLAK IKKIMKADPD 60 VHMVSAEAPI LFAKACEKFI VDLTMRSWLH AEENKRHTLQ KSDISDAVAS SFTYDFLLDV 120 VPKDADPACV PQYNYPPGMY APPPAGEGEY EAGENGGNGG GN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 2e-39 | 33 | 123 | 5 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.15774s0198.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025619 | 1e-121 | AB025619.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MBA10. | |||
GenBank | AB493785 | 1e-121 | AB493785.1 Arabidopsis thaliana At5g50480 mRNA for hypothetical protein, partial cds, clone: RAAt5g50480. | |||
GenBank | BT014783 | 1e-121 | BT014783.1 Arabidopsis thaliana At5g50480 gene, complete cds. | |||
GenBank | BT015006 | 1e-121 | BT015006.1 Arabidopsis thaliana At5g50480 mRNA, complete cds. | |||
GenBank | CP002688 | 1e-121 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002865810.1 | 1e-80 | nuclear transcription factor Y subunit C-6 | ||||
Swissprot | Q9FGP7 | 2e-76 | NFYC6_ARATH; Nuclear transcription factor Y subunit C-6 | ||||
TrEMBL | D7MQ85 | 3e-79 | D7MQ85_ARALL; Uncharacterized protein | ||||
STRING | Bostr.15774s0198.1.p | 1e-118 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM478 | 28 | 160 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50480.1 | 7e-70 | nuclear factor Y, subunit C6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.15774s0198.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|