PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.15697s0122.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 434aa    MW: 47606.2 Da    PI: 5.7603
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.15697s0122.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.32e-05838535
              zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHk 35
                           C+ ++e  + lfC+ +   lC  C ++ H 
  Bostr.15697s0122.1.p  8 PCEFCGERTAVLFCRADTAKLCLPCDQHVHT 38
                          7******99******************9994 PP

2zf-B_box21.74.1e-074980334
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                           ++C+++++++++  C++++  lC++C    H
  Bostr.15697s0122.1.p 49 SQICDNCGNEPVSVRCFTDNLVLCQECDWDVH 80
                          689************************98777 PP

3CCT64.62.9e-22385429145
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                           R +a++RYkeKrktR+++K+irYesRKa+A++R Rv+GrFvk++e
  Bostr.15697s0122.1.p 385 RGNAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVRGRFVKASE 429
                           7789**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.3E-13451IPR000315B-box-type zinc finger
PROSITE profilePS501199.428451IPR000315B-box-type zinc finger
CDDcd000211.24E-8751No hitNo description
PROSITE profilePS501198.6034794IPR000315B-box-type zinc finger
CDDcd000212.64E-85180No hitNo description
SMARTSM003360.845294IPR000315B-box-type zinc finger
PfamPF062031.7E-16385427IPR010402CCT domain
PROSITE profilePS5101714.951385427IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGSLERVPCE FCGERTAVLF CRADTAKLCL PCDQHVHTAN LLSRKHVRSQ ICDNCGNEPV  60
SVRCFTDNLV LCQECDWDVH GSCSVSDAHV RSAVEGFSGC PSASELAALW GLDLEGRKEE  120
NEVPMMMMEN FGMQLDSWVS GSNVLQELIV PSDTTFKKRG SSCGRYKQVL CKQLEELLKN  180
GVVGGGGGGD DDGDRDCDRE GDCDGDGEAG EGIMVPEMPE RLEWARNVEE INGGGGANQL  240
PQKTSFTPLQ WKATIPSGGQ SSQIWDFNLG QSRGPEDTSR MEAAYVAKGA ASFTINNFVD  300
NMNETCSTNV KGVKEICKDD YKRSTSGQVQ PATSESNNLP ITFGSEKGSN SSSDLHFTEH  360
IAGTSCKTTR LVATKADLER LAQNRGNAMQ RYKEKRKTRR YDKTIRYESR KARADTRLRV  420
RGRFVKASEA PYP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.15697s0122.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0372060.0AY037206.1 Arabidopsis thaliana At1g28050/F13K9_15 mRNA, complete cds.
GenBankBT0026810.0BT002681.1 Arabidopsis thaliana At1g28050/F13K9_15 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893503.10.0zinc finger protein CONSTANS-LIKE 15
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLD7KCS10.0D7KCS1_ARALL; Zinc finger (B-box type) family protein
STRINGBostr.15697s0122.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]