PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bostr.13158s0169.1.p

Organism

Boechera stricta

Taxonomic ID

72658

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera

Family

MYB_related

Protein Properties

Length: 79aa MW: 9436.84 Da PI: 8.5057

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bostr.13158s0169.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	28.9	2.7e-09	30	69	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +++eE++l+ + +k+ G + W +Ia +++ gRt++ + +w+ Bostr.13158s0169.1.p 30 MSEEEEDLIFRMHKLVGDR-WLLIAGRIP-GRTPEVIERYWL 69 79*************99.*****.***9999997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	3.7E-7	26	74	IPR001005	SANT/Myb domain
CDD	cd00167	3.47E-6	29	70	No hit	No description
SuperFamily	SSF46689	1.05E-7	29	69	IPR009057	Homeodomain-like
Pfam	PF00249	1.5E-8	30	70	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	6.156	31	68	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.6E-10	31	69	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MDNRRWNRRK TTYASCSEEV TSIEWKAVTM SEEEEDLIFR MHKLVGDRWL LIAGRIPGRT 60 PEVIERYWLM KHGFFFAN*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:12356720, ECO:0000269\|PubMed:16291794, ECO:0000269\|PubMed:19513241, ECO:0000269\|PubMed:9262483}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bostr.13158s0169.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16176989, ECO:0000269\|PubMed:16207757, ECO:0000269\|PubMed:17450124, ECO:0000269\|PubMed:19513241}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002878399.1	1e-48	transcription factor CPC
Swissprot	O22059	2e-37	CPC_ARATH; Transcription factor CPC
TrEMBL	D7LSD5	3e-47	D7LSD5_ARALL; Predicted protein
STRING	Bostr.13158s0169.1.p	4e-52	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46410.1	8e-40	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Bostr.13158s0169.1.p

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Tominaga-Wada R,Wada T The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Kurata T,Wada T Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] Tominaga-Wada R,Kurata T,Wada T Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Tominaga-Wada R,Wada T Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]