PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13083s0065.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 378aa    MW: 41278.8 Da    PI: 5.89
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13083s0065.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.32.4e-06444539
              zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                          +C+ ++e++   +C+++  +lC +C  + H+       H++
  Bostr.13083s0065.1.p  4 MCDFCGEQRSMVYCRSDAACLCLSCDRNVHSAnalskrHSR 44
                          6*****************************65677777776 PP

2zf-B_box231.6e-074688438
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg........Ht 38
                           +C++++ ++++  C d ++ lC++C   +H g        H+
  Bostr.13083s0065.1.p 46 LICERCNAQPASVRCSDEKVSLCQNCDWVGHDGttstttshHK 88
                          68*****************************777777777555 PP

3CCT59.51.2e-20320363144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           R++a++RYkeK+k RkF+K++rY sRK++A+ R RvKGrFvk+ 
  Bostr.13083s0065.1.p 320 RNNAVMRYKEKKKARKFDKRVRYVSRKERADVRRRVKGRFVKSG 363
                           99***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.627147IPR000315B-box-type zinc finger
SMARTSM003368.2E-9447IPR000315B-box-type zinc finger
CDDcd000211.47E-7447No hitNo description
PROSITE profilePS501199.1864392IPR000315B-box-type zinc finger
CDDcd000217.41E-54776No hitNo description
PROSITE profilePS5101715.1320362IPR010402CCT domain
PfamPF062032.5E-15320362IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR NVHSANALSK RHSRTLICER CNAQPASVRC  60
SDEKVSLCQN CDWVGHDGTT STTTSHHKKQ TINCYSGCPS SAELSSIWSF CLDLNMSSAG  120
ESACEQGMGL MTMDEGPGDK SGVQNVNVDQ PGTNSAVQGM DRSSVPENSS LAKELGVCED  180
DFNGNLIMDE VDVALENYEE LFGTAFNSSR YLFEHGGIGS LFEKDEAPEG STQGNSMQQP  240
AVSNNASADS FMTCRTEPII CCSSKPAHSN ISFSGVTGES NAGDFQDCGA SSMKQLSREP  300
QPWCPPTSQD IIASSHATTR NNAVMRYKEK KKARKFDKRV RYVSRKERAD VRRRVKGRFV  360
KSGEAYDYDP MSPARSY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.13083s0065.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0399570.0AY039957.1 Arabidopsis thaliana unknown protein (At5g48250) mRNA, complete cds.
GenBankAY1426070.0AY142607.1 Arabidopsis thaliana unknown protein (At5g48250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010493639.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10
RefseqXP_010493640.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10
RefseqXP_019097594.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10
SwissprotQ9LUA90.0COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLD7MLL30.0D7MLL3_ARALL; Zinc finger (B-box type) family protein
STRINGBostr.13083s0065.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]