PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.12659s0412.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 419aa    MW: 46821.5 Da    PI: 4.9953
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.12659s0412.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.31.6e-081356340
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                          +r C+ + + +++++C  ++ +lC++C +  H+       H++v
  Bostr.12659s0412.1.p 13 ARACDSCVKRRARWYCAADDAFLCQSCDSLVHSAnplarrHERV 56
                          578*****************************657888888876 PP

2CCT68.12.4e-23358401144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Bostr.12659s0412.1.p 358 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 401
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8081158IPR000315B-box-type zinc finger
SMARTSM003368.0E-101158IPR000315B-box-type zinc finger
PfamPF006433.5E-71356IPR000315B-box-type zinc finger
CDDcd000216.23E-101458No hitNo description
PROSITE profilePS5101716.083358400IPR010402CCT domain
PfamPF062036.9E-18358400IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MKSLANAVGA KTARACDSCV KRRARWYCAA DDAFLCQSCD SLVHSANPLA RRHERVRLKT  60
ASPAAVKHSY HSASPPHEAA TWHKGFTRKA RTPRGSGKKN NSSIFHDLVP EISVEDQTDS  120
FELEEQLICQ VPVLDPLVAE QFLNDVVEPK IEFAMIRSGV KIDEEEDNAE SCLNGFFPTD  180
MELEDFAADV ETLLGRGLDT DSYAMEELGF SNSEMFKIEK DEIEEEVEEI KAMNMEIFDD  240
DRKDVDGTVP CELSFDYESS HKTSEEEVMK NVESSGECVV KVKEEEQKNV LMLRLNYESV  300
ISTWGGQGPP WTSGEPPELD IDISGWPAVS MGENGGESHQ KQYVGRCLPS SGFGDGGREA  360
RVSRYREKRR TRLFSKKIRY EVRKLNAEKR PRMKGRFVKR ASLAVSAAAA NSPLGVNY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1368384RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.12659s0412.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2264360.0AK226436.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL06-11-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173915.20.0B-box type zinc finger protein with CCT domain-containing protein
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A178WN780.0A0A178WN78_ARATH; BBX15
STRINGBostr.12659s0412.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]