PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.1040s0052.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 564aa    MW: 64136.6 Da    PI: 6.7535
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.1040s0052.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.43.1e-191181922699
                          T...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  26 h...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          +   +++++++++l+ +d++g +W++k+++r++++r+++t+GW+ F+  ++L +gD++vF   + +++el+v+++r+
  Bostr.1040s0052.1.p 118 NkkpDMSQPSPTQLVAKDLHGHEWRFKHTFRGTPRRHLFTSGWSTFATKKRLIAGDTFVFV--RGENGELRVGIRRA 192
                          3445666779999************************************************..449999******97 PP

2Auxin_resp102.36.3e-34217296183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          ++ha++++++F vvY+Pr+  s+Fvv+++k+++a++ ++ vG+Rf+m+fe+ed++++++sGt++gv+dl+p +W+nS+WrsL+
  Bostr.1040s0052.1.p 217 VVHAFNNQCIFIVVYKPRS--SQFVVSYDKYVDAMNDNFNVGSRFRMRFEGEDFAKKSYSGTITGVNDLSP-HWKNSEWRSLQ 296
                          689***************6..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.7394193IPR003340B3 DNA binding domain
SMARTSM010195.5E-998193IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-23121205IPR015300DNA-binding pseudobarrel domain
PfamPF023628.7E-16124192IPR003340B3 DNA binding domain
SuperFamilySSF1019361.7E-17125193IPR015300DNA-binding pseudobarrel domain
CDDcd100171.20E-14128191No hitNo description
PfamPF065072.8E-29217296IPR010525Auxin response factor
PfamPF023091.2E-7424499IPR033389AUX/IAA domain
SuperFamilySSF542779.81E-12459539No hitNo description
PROSITE profilePS5174520.189463541IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MENNEEMNAQ PGLLGTIDRT KTYMYEQLWS ICAGPLCDLP KPGEKIYYFP QGHIELIETS  60
TREELDQIRP LFDLPSKLRC RVISVQLKAE KNTDEVYAQI SLMPDTTEVI IPITNEDNKK  120
PDMSQPSPTQ LVAKDLHGHE WRFKHTFRGT PRRHLFTSGW STFATKKRLI AGDTFVFVRG  180
ENGELRVGIR RAKHQLGHIP SSVISTQCMK HGLITSVVHA FNNQCIFIVV YKPRSSQFVV  240
SYDKYVDAMN DNFNVGSRFR MRFEGEDFAK KSYSGTITGV NDLSPHWKNS EWRSLQVSPW  300
EIEHLVSSSY ISQSTLLKKE RSRQLNEIGS PSSNLCTFQE IGQPSMSSSM SVPPFSYRDA  360
VEDSKFPSGW LMKDPVPAMP KSNYNNDQMV QPMKEKITTE ATTSCMLFGV DLATPSETKD  420
PLGPIESYHK SEISKLSQDK KLDHTQILTS PNEVQSTQFY STRSRTKVQM QGITIGRAVD  480
LNVLHGYDQL IVELEELFDL KGELRTRNQW ELVFKDNEGD IMLVGDDPWI EEVEKMKSRN  540
KFSQAKSTIS TSSNAEPNVK TDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A3e-922430919359Auxin response factor 1
4ldw_A3e-922430919359Auxin response factor 1
4ldw_B3e-922430919359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.1040s0052.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478873.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9FX250.0ARFM_ARATH; Auxin response factor 13
TrEMBLD7KJF30.0D7KJF3_ARALL; Auxin response factor
STRINGBostr.1040s0052.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14