PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0597s0159.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CO-like
Protein Properties Length: 333aa    MW: 37176.9 Da    PI: 5.4469
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0597s0159.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.94.3e-08245340
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         e+ C+ +  +++ ++C++++  lC +C ++ H+       Ht++
  Bostr.0597s0159.1.p  2 EPQCDYCATEKALIYCKSDSAKLCLNCDVNVHSAnplsqrHTRS 45
                         689******99*********************667888888875 PP

2CCT60.17.6e-21278320143
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                          R++a++RYk+K+++R F K+irY+sRKa+A++R+RvKGrFvk 
  Bostr.0597s0159.1.p 278 RDEAKKRYKQKKSKRMFGKQIRYASRKARADTRKRVKGRFVKT 320
                          99***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.1E-11147IPR000315B-box-type zinc finger
PfamPF006431.2E-6245IPR000315B-box-type zinc finger
CDDcd000212.96E-6347No hitNo description
PROSITE profilePS501199.442547IPR000315B-box-type zinc finger
PfamPF062033.7E-16278320IPR010402CCT domain
PROSITE profilePS5101714.396278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEPQCDYCAT EKALIYCKSD SAKLCLNCDV NVHSANPLSQ RHTRSLLCEK CFLQPTVIHC  60
LNEKVSLCQG CHWTASNCTG LGHRLQYLNP YSGCPSPSDF TKIWSSNLEA SVSNWVSPFD  120
DCTKINELVD WDGLSTPMVT QTQNLKDQSS IFFMESNLPN VIEEECFGLD LCEGINLDDA  180
PLSFNASNDI IGCSSLDQTK CYLYEDSYKE DNNVGLSSLL LPALSRGNVV PSMSLSMSNI  240
TGESSATDYQ DCGISPGFLI GDSPWDSNVE FSYNPKSRDE AKKRYKQKKS KRMFGKQIRY  300
ASRKARADTR KRVKGRFVKT GETFEYDPSP MM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.0597s0159.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010449953.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
SwissprotO233790.0COL11_ARATH; Putative zinc finger protein CONSTANS-LIKE 11
TrEMBLD7MAK30.0D7MAK3_ARALL; Zinc finger (B-box type) family protein
TrEMBLR0GLP70.0R0GLP7_9BRAS; Uncharacterized protein
STRINGBostr.0597s0159.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15250.10.0B-box type zinc finger protein with CCT domain