PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G045200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 358aa    MW: 40620.4 Da    PI: 10.205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G045200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-15655148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                        r+rW +eEd +l  +v+q+G++ W++++++m+  + R +k+c +rw +yl
  Brast10G045200.1.p  6 RQRWRPEEDAILRAYVRQHGPREWSLVSQRMNvaLDRDAKSCLERWKNYL 55
                        89**********************************************97 PP

2Myb_DNA-binding35.62.2e-1161105147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +g+ T eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Brast10G045200.1.p  61 KGSLTDEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 105
                         5778******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.72159IPR017930Myb domain
SMARTSM007171.7E-12557IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-216100IPR009057Homeodomain-like
CDDcd001673.58E-7855No hitNo description
Gene3DG3DSA:1.10.10.605.5E-21862IPR009057Homeodomain-like
PfamPF139211.1E-13969No hitNo description
PROSITE profilePS5129418.68760110IPR017930Myb domain
SMARTSM007175.0E-1060108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-1563104IPR009057Homeodomain-like
CDDcd001677.88E-665106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MQMKERQRWR PEEDAILRAY VRQHGPREWS LVSQRMNVAL DRDAKSCLER WKNYLRPGIK  60
KGSLTDEEQR LVIRLQAKHG NKWKKIAAEV PGRTAKRLGK WWEVFKEKQQ REIRDSRRPP  120
PEPSPDERGR YEWLLENFAE KLVKERQIAA PPAMAGGAPL LPPWMSASNA SAAVAMDVVG  180
PPPPPSVTLS LASAAVAAPP AAAAPWMQQQ QQQQEAFGMV AAARVPASDA MAEVAECCRE  240
LEEGHRAWAA HRKEAAWRLK RVELQLESER ASRRREAAEE FEAKMRALWE EQAAAVERLE  300
QEYRDKVAGL RRDAEIKEQK MAEQWAAKHA RLAKFVDQVA AASSCRRWPP AEINGGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-149103798MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-149103798C-Myb DNA-Binding Domain
1msf_C2e-149103798C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. May interact with other proteins to repress the knox homeobox genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast10G045200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3728391e-153AK372839.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3014B11.
GenBankAK3728891e-153AK372889.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3015B19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579268.10.0protein rough sheath 2
RefseqXP_024318934.10.0protein rough sheath 2
RefseqXP_024318935.10.0protein rough sheath 2
SwissprotQ94IB11e-143RS2_ORYSJ; Protein rough sheath 2 homolog
TrEMBLI1IH970.0I1IH97_BRADI; Uncharacterized protein
STRINGBRADI4G03970.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.17e-67MYB family protein