PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G214600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 428aa    MW: 47136.7 Da    PI: 6.6414
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G214600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Brast08G214600.1.p 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding43.38.3e-1467110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg++ ++E++l++++++ lG++ W+ Ia+ m+ gRt++++k+ w++
  Brast08G214600.1.p  67 RGAFAQDEEDLIIELHAVLGNR-WSQIAAQMP-GRTDNEIKNLWNS 110
                         79999*****************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.791965IPR017930Myb domain
SuperFamilySSF466893.63E-2912108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001673.35E-111761No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2465116IPR009057Homeodomain-like
SMARTSM007179.8E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.38966116IPR017930Myb domain
PfamPF002492.5E-1267110IPR001005SANT/Myb domain
CDDcd001671.78E-872112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF AQDEEDLIIE LHAVLGNRWS QIAAQMPGRT DNEIKNLWNS SLKKKLRQKG  120
IDPNTHKPLA EVDRSGAAPT ISTERTSGSS DVNPSSAGAL GNFSHLLSET AQSSMLLPVY  180
DKKRPETPSL ARPKVPAKEL FLDQLAAGHE SPSSCRSSGP TLYFPFQQPL GYSNECGSGD  240
GANMNSLWFN QNDFNCSTIS TVMPTVSPSA LSTSMGLNLP PDNHRHGGTA ISSAPFYWDG  300
VNPSSSGSTG SSGSNSMGFE PQSTNSILEN SVFPWTDIGQ EKDTRVQLVE ELKWPDLLHG  360
TFAEATTALQ NQSQSLYDDV IKAESQFNME GICASWFQNQ PPQQQLQAPS DMYDKDLQRM  420
PLSFEHM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G214600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8573100.0JN857310.1 Triticum aestivum cultivar Shannong0431 MYB75 (MYB75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568972.10.0transcription factor MYB61 isoform X1
TrEMBLI1HM410.0I1HM41_BRADI; Uncharacterized protein
STRINGBRADI2G36730.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.17e-80myb domain protein 61