PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G160900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 269aa    MW: 28831.3 Da    PI: 8.6703
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G160900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.8e-191156147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEdell  av ++G ++W+ I+ +++ gR++k+c++rw + 
  Brast08G160900.1.p 11 KGSWSPEEDELLRAAVSRHGARNWSVISGEVP-GRSGKSCRLRWCNQ 56
                        799*****************************.***********985 PP

2Myb_DNA-binding56.18.7e-1863107147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++T+eEd ++v+a+++ G++ W++Iar++  gRt++++k++w++ 
  Brast08G160900.1.p  63 RRAFTPEEDAIIVQAHNECGNK-WAAIARRLV-GRTDNSVKNHWNST 107
                         678*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.284661IPR017930Myb domain
SuperFamilySSF466894.49E-308104IPR009057Homeodomain-like
SMARTSM007173.4E-161059IPR001005SANT/Myb domain
PfamPF002491.1E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-241264IPR009057Homeodomain-like
CDDcd001676.55E-161355No hitNo description
PROSITE profilePS5129421.1362112IPR017930Myb domain
SMARTSM007177.5E-1662110IPR001005SANT/Myb domain
PfamPF002491.2E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2265111IPR009057Homeodomain-like
CDDcd001677.21E-1365108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MVPSTGAGRV KGSWSPEEDE LLRAAVSRHG ARNWSVISGE VPGRSGKSCR LRWCNQLSPG  60
VHRRAFTPEE DAIIVQAHNE CGNKWAAIAR RLVGRTDNSV KNHWNSTLRR NRRAAAAAAA  120
AGNAVLFAPV SMSSFQSLNL TEEEDDDDSD NNSPPTKRQC VGIAPLAVKL QEEAPPDPPT  180
SLSLSLPGVG SSTAPELVSE RAKLEQNPWL KAAMQQMVAE EVHRHMGSVY TALMASLDSG  240
GAANPPKARI DRAAAASRDQ KADGRMDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-34101103103C-Myb DNA-Binding Domain
1msf_C5e-34101103103C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G160900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1362211e-82AC136221.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077J17, complete sequence.
GenBankAP0149611e-82AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-82CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566355.11e-121transcription factor MYB77
SwissprotQ9SN123e-47MYB77_ARATH; Transcription factor MYB77
TrEMBLI1HKE61e-119I1HKE6_BRADI; Uncharacterized protein
STRINGBRADI2G28910.11e-120(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-47myb domain protein 70
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]