PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G105400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 221aa    MW: 24108.9 Da    PI: 7.186
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G105400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65.1e-074691346
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                        +WT+ Ed+ +  a   ++ +   +W+ +a+ ++ gRt+ +  +++q 
  Brast08G105400.1.p 46 PWTKAEDKVFESALVAFPEHvqnRWAYVASQLP-GRTPQEAWEHYQA 91
                        8*****************99*************.****998888875 PP

2Myb_DNA-binding44.92.7e-14155199347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +W++eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  Brast08G105400.1.p 155 PWSEEEHRLFLEGLEKYGRGDWRNISRWAVKTRTPTQVASHAQKY 199
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.3364197IPR017930Myb domain
SMARTSM007170.034395IPR001005SANT/Myb domain
SuperFamilySSF466893.11E-1145100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-74691IPR009057Homeodomain-like
CDDcd001675.17E-44693No hitNo description
PROSITE profilePS5129418.357148204IPR017930Myb domain
SuperFamilySSF466892.14E-17150203IPR009057Homeodomain-like
SMARTSM007172.8E-10152202IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.8E-16152202IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-11154198IPR009057Homeodomain-like
CDDcd001674.17E-10155200No hitNo description
PfamPF002491.5E-11155199IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MAFYGGMGMG MGAGASSSQQ AHGRRQQQQQ PMMMMSAPVP MPSVRPWTKA EDKVFESALV  60
AFPEHVQNRW AYVASQLPGR TPQEAWEHYQ ALLEDLDLIE NGFIETPESW DEEEEAAAAA  120
AAAATAAAAA AAAASAAAGG GARRGRGEER RRGVPWSEEE HRLFLEGLEK YGRGDWRNIS  180
RWAVKTRTPT QVASHAQKYF LRLAGKGDTK RKSIHDVTNP *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast08G105400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679544e-54AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566206.32e-90transcription factor DIVARICATA
TrEMBLA0A2K2DA655e-89A0A2K2DA65_BRADI; Uncharacterized protein
STRINGOGLUM05G19240.15e-80(Oryza glumipatula)
STRINGORUFI05G19340.15e-80(Oryza rufipogon)
STRINGOS05T0442400-015e-80(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-39Homeodomain-like transcriptional regulator