PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast08G096900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 97aa MW: 10831.3 Da PI: 8.7229 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 99.2 | 3.2e-31 | 36 | 92 | 35 | 91 |
NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 ++ecvsefisfvtseasdkc++ekrkt+ngddllw atlGfe+yv+plk+yl+ky Brast08G096900.1.p 36 MKECVSEFISFVTSEASDKCHNEKRKTVNGDDLLWVTATLGFEKYVDPLKIYLHKYT 92 68******************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.2E-4 | 17 | 36 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.51E-22 | 23 | 92 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.7E-12 | 35 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-19 | 36 | 54 | No hit | No description |
Gene3D | G3DSA:1.10.20.10 | 2.4E-26 | 37 | 93 | IPR009072 | Histone-fold |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.2E-19 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 2.2E-19 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MADGGSHDNG RPKGGGGGVV REQDRFLRIA NISRIMKECV SEFISFVTSE ASDKCHNEKR 60 KTVNGDDLLW VTATLGFEKY VDPLKIYLHK YTNKWP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-30 | 21 | 91 | 3 | 91 | NF-YB |
4awl_B | 2e-30 | 21 | 91 | 4 | 92 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-30 | 21 | 91 | 4 | 92 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast08G096900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK376672 | 1e-48 | AK376672.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3131D13. | |||
GenBank | BT009393 | 1e-48 | BT009393.1 Triticum aestivum clone wlm96.pk037.k9:fis, full insert mRNA sequence. | |||
GenBank | GU902788 | 1e-48 | GU902788.1 Triticum monococcum nuclear transcription factor Y subunit B4 mRNA, partial cds. | |||
GenBank | JF764601 | 1e-48 | JF764601.1 Hordeum vulgare NF-YB2 mRNA, complete cds. | |||
GenBank | KJ862215 | 1e-48 | KJ862215.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B4 mRNA, complete cds. | |||
GenBank | KM078741 | 1e-48 | KM078741.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D4) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003564550.1 | 4e-45 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q5QMG3 | 3e-40 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | I1HT46 | 1e-43 | I1HT46_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G54200.1 | 2e-44 | (Brachypodium distachyon) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-39 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast08G096900.1.p |